The URL can be used to link to this page

Home My WebLink About1123 S Magnolia Ave Unit# 2 - PlanAD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 This drawings,specifications and ideas, with these drawings shall constitute evidence ORDINANCE FORMS SHEET TITLE REVISIONS designs thereby are and shall remain the property of F. SOLIS (Designer) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F.SOLIS,visual contact of acceptance of these restrictions. A-1.2 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 ELECTRICAL: 1. ALL ELECTRICAL WORK TO CONFORM WITH UTILITY COMPANY REQUIREMENTS AND LOCAL CODES. 2. ELECTRICAL CONTRACTOR SHALL OBTAIN AND PAY FOR ALL PERMITS. 3. CONTRACTOR SHALL INSPECT EXISTING SERVICE PRIOR TO SUBMITTING BID TO INSURE ADEQUACY FOR NEW EQUIPMENT AND ELECTRICAL. A NEW SERVICE OF PROPER SIZE SHALL BE PART OF THE\ CONTRACT IF REQUIRED. 4. FIXTURES TO BE SELECTED BY OWNER AND INSTALLED BY ELECTRICIAN 5. PROVIDE ALL BATHROOM AND EXTERIOR OUTLETS ON GROUND FAULT DETECTOR CIRCUITS. HEATING:(CONTINUED) 6)ALL EXHAUST SYSTEMS SHALL HAVE DAMPERS. 7)PROVIDE SETBACK THERMOSTAT ON ALL HEATING OR COOLING SYSTEMS EXCEPT HEAT PUMPS. B)FAN SYSTEMS: 1) FAN SYSTEMS EXHAUSTING AIR FROM THE BUILDING TO THE OUTSIDE SHALL BE PROVIDED BACK-DRAFT DAMPERS INSTALLED TO PREVENT AIR LEAKAGE WHEN THE FAN IS NOT OPERATING. C) INSTALLATION AND WORKMANSHIP: 1) ALL WORK SHALL BE PERFORMED IN THE BEST PRACTICE OF THE TRADE AND CONFORMING TO ALL APPLICABLE CODES. REGISTERS SHALL BE LOCATED IN ALL ROOMS. SEE DRAWINGS FOR LOCATIONS. UPON COMPLETION, THIS CONTRACTOR SHALL CHECK OUT AND BALANCE THE SYSTEM. D) HEATING AND VENTILATING CONTRACTOR SHALL FURNISH ALL MECHANICAL DRAWINGS FOR CONSTRUCTION AND PERMITS. ALL. WORK TO COMMON WITH THE LATEST CODE AND SAFETY REGULATIONS. OCCUPANCY LIFE SAFETY: 1. PROVIDE 110V SMOKE ALARMS(DETECTORS) WITH BATTERY BACKUP IN ALL SLEEPING ROOMS , HALLWAYS AND ROOMS LEADING TO THE ROOMS. THE DETECTOR SHALL SOUND ALARM AUDIBLE IN ALL SLEEPING ROOMS OF THE DWELLING. SECURITY: 1. SWINGING DOORS: A)DOOR STOPS OF IN-SWINGING DOORS SHALL BE OF ONE PIECE CONSTRUCTION WITH THE JAMS OR JOINED BY RABBET TO THE JAMBS. B)ALL PIN TYPE HINGES WHICH ARE ACCESSIBLE FROM OUTSIDE THE SECURED AREA WHEN THE DOOR IS CLOSED SHALL HAVE NON-REMOVABLE HINGE PINS. IN ADDITION, THEY SHALL HAVE ¼" STEEL JAM STUD WITH ¼" MINIMUM PROJECTION UNLESS THE HINGES ARE SHAPED TO PREVENT REMOVAL OF THE DOOR IF THE PINS ARE REMOVED. C)THE STRIKE PLATE FOR LATCHES AND THE BOLDING DEVICE FOR PROJECTING DEADBOLTS IN WOOD CONSTRUCTION SHALL BE SECURED TO THE JAM AND WALL FRAMING WITH 2 ½" LONG SCREWS. D)DEADBOLTS SHALL HAVE HARDENED INSERTS, MIN 1" THROW EMBEDMENT 5/8". E)WOOD FLUSH DOORS SHALL BE IN MIN 1 3/8" THICK, SOLID CORE, PANEL TYPE MIN PANEL THICKNESS 9/16. MAX 300 SQ. INCHES IN AREA. F)GLASS DOORS SHALL HAVE FULLY TEMPERED GLASS. 2.CYLINDER GUARDS HALL BE INSTALLED ON ALL CYLINDER LOCKS WHENEVER THE CYLINDER PROJECTS BEYOND THE FACE OF THE DOOR OR IS OTHERWISE EXPOSED TO GRIPPING TOOLS. 3.SLIDING GLASS DOORS AND WINDOWS SHALL BE ALE TO RESIST THE TESTS SET FORTH IN 91.6731 AND 91.6732 OF THE BUILDING CODE. 4.SLIDING GLASS DOORS AND WINDOWS SHALL BE PROVIDED WITH A DEVICE IN THE UPPER CHANNEL OF THE MOVING PANEL TO PROHIBIT RAISING AND REMOVING OF THE PANEL IN THE CLOSED OR PARTIALLY OPEN POSITION. 5.PROVIDE HARDENED LOCK AND LATCH ON OVERHEAD GARAGE DOORS OVER 9'0" IN LENGTH. 6.GLAZED OPENINGS WITHIN 40" OF THE DOOR LOCK WHEN THE DOOR IS IN THE CLOSED POSITION SHALL BE FULLY TEMPERED GLASS. 7.USE DEAD LOCKING LATCH KEY OPERATED LOCKS ON EXTERIOR; LOCKS OPEN ABLE WITHOUT KEY OR SPECIAL KNOWLEDGE OR EFFORT ON INTERIOR. 8.INACTIVE LEAF OF ALL EXTERIOR DOUBLE DOORS SHALL HAVE APPROVED SLIDE BOLD LOCKING DEVICE AT TOP AND BOTTOM. 9.PROVIDE 110V SMOKE ALARMS(DETECTORS) WITH BATTERY BACKUP IN ALL SLEEPING ROOMS , HALLWAYS AND ROOMS LEADING TO THE ROOMS. THE DETECTOR SHALL SOUND ALARM AUDIBLE IN ALL SLEEPING ROOMS OF THE DWELLING. 3)STAIN SHALL BE MONSANTO CHEMICAL OR OLYMPIC. 4)ALL WORK TO BE IN ACCORDANCE WITH BEST PRACTICES OF THE TRADE. E. MISCELLANEOUS: REFER TO PLANS FOR SPECIFIC MATERIALS AND FINISHES. ENERGY:(CONTINED) 7)THE BUILDER SHALL PROVIDE THE ORIGINAL OCCUPANT A LIST OF THE HEATING, COOLING, WATER HEATING, LIGHTING SYSTEMS AND CONSERVATION OR SOLAR DEVICES INSTALLED IN THE BUILDING AND INSTRUCTIONS ON HOW TO USE THEM EFFICIENTLY. 8)A MAINTENANCE LABEL SHALL BE AFFIXED TO ALL EQUIPMENT REQUIRING PREVENTIVE MAINTENANCE, AND A COPY OF THE MAINTENANCE INSTRUCTIONS SHALL BE PROVIDED FOR THE OWNER'S USE. 9)ALL INSULTING MATERIALS SHALL BE CERTIFIED BY THE MANUFACTURER AS COMPLYING WITH CALIFORNIA QUALITY STANDARDS FOR INSULATION. A. HEATING AND COOLING 1) IF HEATING IS TO BE ACCOMPLISHED BY EXTENDING DUCTS FROM AN EXISTING FORCED AIR UNIT, NO EQUIPMENT SIZING WILL BE REQUIRED. 2)IF NEW HEATING EQUIPMENT IS NEEDED, HEAT LOSS CALCULATING MUST BE PREPARED TO SIZE SYSTEM. 3)NEW UNIT MUST BE EQUIPPED WITH A PROGRAMMABLE HIGH SET-BACK THERMOSTAT. 4)DUCTS SHALL BE CONSTRUCTED, INSTALLED AND INSULATED ACCORDING TO CHAPTER 10 OF THE UNIFORM MECHANICAL CODE ALL PARTS OF THE DUCT SYSTEM SHALL BE TIGHTLY SEALED WITH MASTIC OR TAPE. 5)THE FOLLOWING OPENINGS IN THE BUILDING ENVELOPE SHALL BE CAULKED OR OTHERWISE SEALED TO LIMIT INFILTRATION: A) EXTERIOR JOINTS AROUND WINDOWS AND DOOR FRAMES, BETWEEN WALL SOLE PLATES AND FLOORS, AND BETWEEN EXTERIOR WALL PANELS. B) OPENINGS FOR PLUMBING, ELECTRICITY AND GAS LINES IN WALLS, CEILINGS, AND FLOORS. C) OPENINGS IN ATTIC FLOOR. D) ALL OTHER SUCH OPENING IN BUILDING ENVELOPE. 6)STORAGE TYPE WATER HEATERS AND STORAGE BACK-UP TANKS FOR SOLAR WATER HEATING SYSTEMS SHALL BE EXTERNALLY WRAPPED WITH INSULATION OR R-12 OR GREATER. 7)PIPING IN UNCONDITIONED SPACE LEADING TO AND FROM WATER HEATERS SHALL BE WRAPPED WITH INSULATION R-3 FOR 5' OF PIPE NEXT TO WATER HEATER. 8)RECIRCULATING HOT WATER PIPING IN UNHEATED SPACES SHALL BE INSULATED. 9)GAS FIRED COOKING APPLIANCES, SHOWER HEADS AND FAUCETS SHALL COMPLY WITH THE APPLIANCE EFFICIENCY STANDARDS. B.WATER HEATING: 1) INSULATE TANK WITH R-12 EXTERNAL BLANKET. 2) INSULATE INLET AND OUTLET PIPES WITH R-3 FIRST 5 FEET. 3) SHOW MAKE, MODEL, AND SIZE OF WATER HEATER ON PLANS. D. LIGHTING: 1)GENERAL LIGHTING IN KITCHENS AND BATHS SHALL HAVE AN EFFICIENCY OF NOT LESS THAN 25 LUMENS PER WATT, EXCEPT THAT LUMINARIES USED AS THE ONLY LIGHTING IN BATHS ARE EXEMPT FROM THIS REQUIREMENT. PLUMBING: 1. GENERAL: 1) PLATE STRAPS SHALL BE USED TO REPAIR STUDS, PLATES, AND TRIMMERS WHERE CUT OR DRILLED MORE THAN ONE-HALF THE DEPTH. 2)ALL PIPING THROUGH WALLS SHALL BE FILLED WITH MASTIC AND COVERED WITH ESCUTCHEONS PLATES. 3)PLUMBING VENTS SHALL NOT BE LOCATED CLOSER THAN 10 FEET FROM ANY PROPERTY LINE. 4) ALL METALLIC PIPING UNDER SLAB SHALL BE SLEEVED. 5)ALL WATER CLOSETS SHALL BE 1.28 GALLONS PER FLUSH MAXIMUM. 6)ALL SINKS AND LAVATORIES SHALL BE 1.5 GALLONS PER MINUTE. 7) ALL SHOWERS HEADS SHALL BE 2.0 GALLONS PER MINUTE. 8)ALL HOSE BIBS SHALL HAVE NON-REMOVABLE TYPE LISTED BACK FLOW PREVENTION DEVICES WITHOUT ATTACHED HOSE 9)NO CELLULAR CORE ABS-DWV WILL BE USED. 2.WATER PIPING: A)MATERIALS: 1)COPPER TUBE FOR WATER PIPING SHALL HAVE A WRIGHT OF NOT LESS THAN THAT OF COPPER WATER TUBE TYPE L. EXCEPTION: TYPE W COPPER TUBING MAY BE USE FOR WATER PIPING WHEN PIPING IS ABOVE GROUND, AND THE NORMAL MAXIMUM PRESSURE DOES NOT EXCEED 100 POUNDS, AND THE WORKING TEMPERATURE DOES NOT EXCEED 210 F. B)WATER HEATER: 1)WATER HEATER SHALL BE ANCHORED OR STRAPPED. STRAPPING SHALL BE AT A POINT WITHIN UPPER AND LOWER ONE THIRD (1/3) OF ITS DIMENSIONS. 2)WATER HEATER INSULATION BLANKET (R-16 OR GREATER) REQUIRED AND FIRST FIVE FEET OF PIPES CLOSETS TO TANK TO BE INSULATED (R-3). 3)WATER HEATER WILL HAVE TEMPERATURE AND PRESSURE RELIEF VALVE THAT WILL VENT TO EXTERIOR OUTLET SHALL NOT BE HIGHER THE 24" OR LOWER THEN 6" ABOVE GRADE. 3.GAS PIPING: A)MATERIALS: 1)ALL PIPE USED FOR THE INSTALLATION OF ANY GAS PIPING SHALL BE STANDARD WEIGHT WROUGHT IRON OR STEEL(GALVANIZED OR BLACK). YELLOW BRASS (CONTAINING NOT MORE THAN SEVENTY-FIVE (75) PERCENT COPPER), OR INTERNALLY TINNED OR EQUIVALENTLY TREATED COPPER OF IRON PIPE SIZE. 2)ALL FITTINGS USED IN CONNECTION WITH THE ABOVE PIPING SHALL BE OF MALLEABLE IRON OR YELLOW BRASS (CONTAINING NOT MORE THAN SEVENTY-FIVE (75) PERCENT COPPER. 3)GAS COOKING APPLIANCES TO BE EQUIPPED WITH INTERMITTENT IGNITION DEVICE. 4)MASONRY AND FACTORY-BUILT FIREPLACES SHALL HAVE: a)TIGHT FITTING, CLOSABLE METAL OR GLASS DOOR. b)OUTSIDE AIR INTAKE WITH DAMPER AND CONTROL. c)FLUE DAMPER AND CONTROL. d)NO CONTINUOUS BURNING GAS PILOT ALLOWED. 4.WASTE PIPING: MATERIALS: 1) ALL WASTE PIPING WHICH PENETRATES WALLS WITH (L) HOUR FIRE RESISTIVE MATERIALS APPLIED SHALL BE CAST IRON OR OTHER NONCOMBUSTIBLE PIPING MATERIAL APPROVED BY THE UNIFORM BUILDING CODE APPLICABLE EDITION, STATE AND LOCAL CODES. 2)RAPID FIT WASTE AND OVERFLOW FITTINGS SHALL BE USE IN LIEU OF ACCESS PANEL AS PER I.A.P.M.O. FILE NO. 966. GENERAL REQUIREMENTS: 1. ALL WORK SHALL CONFORM TO THE MINIMUM STANDARDS OF THE LATEST EDITION OF THE california BUILDING CODE AND SUCH OTHER REGULATING AGENCIES EXERCISING AUTHORITY OVER ANY PORTION OF THE WORK. 2. THE CONTRACTOR SHALL VERIFY AND BE RESPONSIBLE FOR ALL DIMENSIONS AND CONDITIONS AT THE SITE AND SHALL NOTIFY THE ARCHITECT OR DESIGNER OF DISCREPANCIES BETWEEN THE ACTUAL CONDITIONS AND INFORMATION SHOWN ON DRAWINGS BEFORE PROCEEDING WITH THE WORK. 3. CONTRACTOR SHALL CONSULT ALL REPRESENTATIVES OF CITY, GAS,LIGHT, WATER, POWER AND PHONE COMPANIES CONCERNING AVAILABLE FACILITIES, REPORT COMMENCING WORK OR CONNECTING FACILITIES. 4. THE CONTRACT DOCUMENTS CONSISTS OF THE AGREEMENT, THE GENERAL CONDITIONS OF THE CONTRACT, THE DRAWINGS AND SPECIFICATIONS, INCLUDING ALL MODIFICATIONS THEREOF INCORPORATED IN THE DOCUMENTS BEFORE EXECUTION. 5. THE SUB-LETTING OF THE WORK BY THE CONTRACTOR SHALL NOT IN ANY WAY RELIEVE HIM OF ANY RESPONSIBILITY OR OBLIGATION TO THE OWNER, ARCHITECT OR DESIGNER, OR THE CONTRACT. 6. CONSTRUCTION AND STORAGE OPERATIONS SHALL BE KEPT WITHIN THE AREAS DESIGNED BY THE OWNER. NO MATERIAL OR EQUIPMENT SHALL BE STORED IN OTHER AREAS. 7. THE GENERAL CONTRACTOR AND EACH SUB-CONTRACTOR SHALL CARRY INSURANCE TO COVER THE PUBLIC AND WORKMAN'S COMPENSATION DURING THE ENTIRE JOB. CERTIFICATE OF SAME SHALL BE FILED WITH THE OWNER. 8. THE CONTRACTOR SHALL EXECUTE THE WORK WITH THE UTMOST DISPATCH. BAILING IN THIS, OWNER SHALL HAVE THE RIGHT, UPON FIVE DAYS WRITTEN NOTICE, TO PURCHASE MATERIALS AND TO EMPLOY MEN TO EXECUTE THE WORK, AND THE COST OF SAID MATERIALS AND LABOR SHALL BE DONE BY THE CONTRACTOR. 9. CLEAN UP; a) PERIODIC CLEAN-UP: EMPTY ALL REFUSE BARRELS AND CANS AND REMOVE RUBBISH AND DEBRIS FROM THE SITE AT LEAST ONCE EVERY WEEK DURING THE CONSTRUCTION PERIOD. b) COMPLETION: UPON COMPLETION OF THE WORK, REMOVE THE RUBBISH FROM OR ABOUT THE BUILDING AS WELL AS ALL TOOLS, SCAFFOLDING, AND SURPLUS MATERIALS. IN CASE OF DISPUTE BETWEEN THE CONTRACTOR AND OTHER CONTRACTORS, AS TO RESPONSIBILITY FOR REMOVAL OR RUBBISH, ETC., OR IN CASE RUBBISH, ETC., IS NOT PROMPTLY REMOVED. THE OWNER MAY REMOVE RUBBISH, ETC., AND CHARGE THE COST TO THE CONTRACTOR. c) FINAL CLEANING: IMMEDIATELY PRIOR TO FINAL INSPECTION, GIVE THE ENTIRE BUILDING A FINAL CLEANING, INCLUDING REMOVAL OF THE PROTECTIVE COVERING MATERIALS APPLIED TO ALUMINUM AND OTHER MATERIALS, REMOVAL OF LABELS, WASHING GLASS, FLOORS AND TILE SURFACES, WAXING RESILIENT FLOORING, CLEANING AND POLISHING PLUMBING FIXTURES, HARDWARE, AND OTHER METAL, CLEANING EQUIPMENT, AND REMOVAL OF ALL TOOLS, EQUIPMENT, DEBRIS, TEMPORARY FACILITIES, ETC. AS REQUIRED TO PREPARE THE BUILDING FOR OCCUPANCY. 10.ALL CONDITIONS NOTED AS EXISTING OR SHOWN AS EXISTING ARE BASED ON THE BEST INFORMATION AVAILABLE AT THE TIME OF PREPARATION OF THE DRAWINGS. NO WARRANTY IS IMPLIED AS TO THE ACCURACY OF THE ITEMS REFERRED AS EXISTING. SITE WORK: 1.THERE SHALL BE NO TRENCHES OR EXCAVATIONS 5 FEET OR MORE IN THE DEPTH INTO WHICH A PERSON IS REQUIRED TO DESCEND. 2.UNDERGROUND UTILITIES: THE CONTRACTOR SHALL VERIFY THE LOCATION OF ALL UNDERGROUND UTILITIES PRIOR TO COMMENCING DEMOLITION, EXCAVATIONS, OR GRADING. DISCONNECT AND CAP OR PROTECT AS REQUIRED. 3.GRADE SITE TO ELEVATIONS FROM ON GRADING PLAN. CUT OR FILL AS REQUIRED. ALL PORTIONS OF THE SITE, INCLUDING YARDS, ARRAYS, COURTYARDS AND PASSAGEWAYS SHALL BE PROPERLY GRADED SO THAT WATER DRAINS AWAY FROM THE BUILDINGS. 4.ALL EXCESS DIRT AND TRASH ARE TO BE REMOVED FROM SITE. 5.ALL GRADING TO BE PERFORMED I ACCORDANCE WITH ALL APPLICABLE CODES AND LOCAL OR ORDINANCES AND THE APPROVED SOILS AND/OR GEOLOGY REPORT. 6.UPON COMPLETION ALL WOOD, PLASTER, OR OTHER DEBRIS SHALL BE CLEARED FROM THE SITE. GRADING SHALL BE PREFORMED SO THAT ALL SURFACE WATER DRAINS RAPIDLY AWAY FROM THE STRUCTURE AND THEN PROPERLY TO THE DRAINAGE DEVICES OR THE STREET. FOUNDATIONS: 1.FOUNDATION SHALL BEAR AS DETAILED ON THE PLANS AND/OR INDICATED IN THE SOIL REPORT. 2.DESIGN SOIL BEARING PRESSURE INDICATED IN THE STRUCTURAL CALCS. 3.FOOTING ELEVATIONS SHOWN ON THE PLANS ARE FOR ESTIMATING PURPOSES ONLY AND SHALL BE VERIFIED IN THE FIELD. 4.EXCAVATIONS ADJACENT TO EXISTING BUILDINGS OR WALLS SHALL NOT EXTEND BELOW AN ANGLE OF 45 DEGREES FROM THE BOTTOMS OF THE FOOTINGS OF THESE ADJACENT STRUCTURES, OR THE CONTRACTOR SHALL PROVIDE ADEQUATE SHORING FOR THE EXCAVATIONS. 5.WHERE EXISTING FOOTINGS, CONCRETE SLABS, PIPES, UTILITIES OR OTHER BURIED ITEMS ARE REMOVED, WHERE NEW SLABS OR FOOTINGS ARE TO BE LOCATED, ALL EXISTING LOOSE SOIL SHALL BE REMOVED AND RECOMPUTED TO A MINIMUM OF 90% OF MAXIMUM DENSITY. 6.ALL FILL SHALL BE COMPACTED TO A MINIMUM OF 90% OF MAXIMUM DENSITY IN ACCORDANCE WITH ASTM D-1557. FILL SHALL BE PLACED UNDER THE SUPERVISION OF, AND TESTED AND CERTIFIED BY, AN APPROVED SOIL'S ENGINEER. 7.ANCHOR BOLTS SHALL BE 5/8" DIAMETER X 12" WITH 9" MIN. EMBEDMENT, SPACING 6' MAXIMUM UNLESS NOTED OTHERWISE. SEE PLANS FOR SPACING. INSTALL A MINIMUM 2 BOLTS IN EACH PIECE OF SILL PLATE AND MINIMUM OF 12" FROM SILL ENDS. USE ONE PLATE WASHER: 0.229"X 3"X 3" 8.HOLD DOWN HARDWARE MUST BE SECURED PRIOR TO THE FOUNDATION INSPECTION MASONRY:(Continued) 1.NO. S SIEVE AND ALL PASSING 3/8 INCH SIEVE. 2.CONCRETE BLOCK SHALL BE PLACED IN ACCORDANCE WITH CHAPTER 24 OF THE BUILDING CODE. 3.VERTICAL STEEL: SET AND BRACE BEFORE PROCEEDING WITH MASONRY WORK. 10.LAPS: 40 DIAMS. AT SPLICES, CORNERS AND INTERSECTIONS. 11.CONTINUOUS INSPECTION: NOT REQUIRED 12.REINFORCING STEEL SHALL BE DEFORMED BARS CONFORMING TO A.S.T.M. DESCRIPTION A15 AND A305EXCEPT THAT ¼" TIES MAY BE PLAIN BARS. WIRE REINFORCEMENT SHALL CONFORM TO A.S.T.M DESIGNATION A82. 13.WORKMANSHIP: CONSTRUCTION SHALL BE OF THE HIGHEST QUALITY WORKMANSHIP AND ALL WALLS SHALL BE LAID TRUE AND PLUMB. PROVISIONS SHALL BE ARRANGED FOR ALL ADJOINING CONSTRUCTION. ALL WALLS TO HAVE FLUSH JOINTS READY TO RECEIVE PLASTER OR WATERPROOFING. 14.TOOL ALL JOINTS, UNLESS INDICATED ON DRAWINGS OTHERWISE. CONCRETE: 1.ALL CONCRETE SHALL BE MADE WITH STONE AGGREGATE AND SHALL ATTAIN A MINIMUM COMPRESSIVE STRENGTH AT 28 DAYS OF 2500 PSI. 2.MAXIMUM CONCRETE SLUMP SHALL BE 3" 3.CEMENT FOR CONCRETE, MORTAR, AND GROUT SHALL BE TYPE I OR II CONFIRMING AT ASTM C-150. AGGREGATE SHALL CONFORM TO ASTM C-33 4.NO PIPES OR DUCTS, OTHER THAN CONDUIT, SHALL BE PLACED IN STRUCTURAL CONCRETE UNLESS SPECIFICALLY SHOWN. ALUMINUM CONDUIT SHALL NOT BE USED. 5.VERIFY WITH ARCHITECTURAL, MECHANICAL, AND ELECTRICAL DRAWING LOCATION OF ALL ITEMS IN OR ATTACHED TO CONCRETE. 6.DRYPACK SHALL BE 1:3 CEMENT AND SAND MIX. ASPHALTIC PAVING: 1.SUBGRADE: SCARIFY & COMPACT TO 90%. FILL OR CUT AS REQUIRED. REMOVE DEPRESSIONS AND HIGH POINTS AND BRING ENTIRE AREA TO SMOOTH PLANE. APPLY SOIL POISONING AGENT. 2.BASE AGGREGATE: 4" THICK ASE COURSE OF ¾MAXIMUM TYPE A MEDIUM AGGREGATE, 1" THICK SURFACING COURSE OF 3/8" MAXIMUM TYPE A MEDIUM AGGREGATE, FOG SEAL. PLACE, SPREAD AND COMPACT IN ONE CONTINUOUS OPERATION. BARRICADE UNTIL CURED. 3.OUTLINES OF ALL PAVING SHALL BE 1" X 3" HEADER BOARDS. METAL: A. STRUCTURAL STEEL. 1.STRUCTURAL STEEL ROLLED SECTIONS AND PLATE USED IN THE WORK SHALL CONFORM TO ASTM A36. 2.PIPE COLUMNS SHALL BE WELDED SEAMLESS PIPE CONFORMING TO ASTM A53 FOR GRADE "B" PIPE. 3.SQUARE OR RECTANGULAR TUBES SHALL BE WELDED SEAMLESS SECTIONS MADE OF STEEL CONFORMING TO ASTM A36. 4.ALL FABRICATION SHALL BE DONE IN THE SHOP OF FABRICATOR LICENSED BY THE BUILDING OFFICIAL OR UNDER THE CONTINUOUS INSPECTION OF A REGISTERED DEPUTY INSPECTOR LICENSED BY THE SAME BODY. 5.BOLTED CONNECTIONS USED IN THE WORK SHALL CONSIST OF UNFINISHED BOLTS CONFORMING TO ASTM A307. 6.ALL WELDING SHALL CONFORM TO THE STANDARD CODE FOR ABC AND GAS WELDING OF THE AMERICAN WELDING SOCIETY. B. SHEET METAL 1.ALL FLASHING, COUNTER FLASHING, AND COPING WHEN OF METAL SHALL BE OF NOT LESS THAN NO. 26 U.S. GAUGE CORROSION-RESISTANT METAL. FLASH ALL PENETRATIONS. 2.FLASH AND COUNTER FLASH AT ALL ROOF TO WALL CONDITIONS. G.I. FLASH AND CAULK WOOD BREAMS AND OUTLOOKERS PROJECTING THROUGH EXTERIOR WALLS OR ROOF SURFACES. 3.NAILS SHALL BE LONG ENOUGH TO GIVE A MINIMUM PENETRATIONS OF ¾INTO WOOD,1" INTO MAILING CONCRETE. 4.SCREWS TO BE PLATED WITH ZINC OR CADMIUM INTO METAL AND EITHER 1" SLATING NAILS NOT SMALLER THAN NO. 6 BY 1" SCREWS INTO LEAD PLUGS. MOISTURE PROTECTION: 1.WEATHER-STRIP ALL DOORS AND WINDOWS EXPOSED TO THE EXTERIOR AL DOORS AND WINDOWS TO BE CERTIFIED. 2.METAL PLASTER GROUND WITH WEEP HOLES SHALL BE INSTALLED AT THE EXTERIOR OF THE BUILDING, AT THE INTERSECTION OF THE MUDSILL AND THE CONCRETE SLAB. SCREWED, TO BE 26 GAUGE CORROSION RESISTANT METAL WITH ¼" ROUND WEEP HOLES AT 3" O.C. 3.ALL JOINTS AND PENETRATIONS TO OUTSIDE TO BE CAULKED AND SEALED. 4.MOISTURE BARRIER: PROVIDE ONE (1) LAYER 15 POUND ASPHALT SATURATED FELT MINIMUM UNDER ALL EXTERIOR FINISHERS. 5.MATERIALS: ALL EXTERIOR MATERIALS SHALL CONFORM TO THE REQUIREMENTS OF THE UNIFORM BUILDING CODE APPLICABLE EDITION, STATE AND LOCAL CODES. INSULATION: 1. ALL EXTERIOR WALLS, WALLS BETWEEN LIVING SPACE AND UNHEATED GARAGE OR STORAGE ROOM, BETWEEN JAMBS AND FRAMING, CEILINGS WITH COLD AREAS ABOVE, ATTIC ACCESS PANEL, KNEE WALLS ADJACENT TO HEATED SPACE, BETWEEN COMBINATION RAFTER AND CEILING JOIST (LEAVE OPEN SPACE ABOVE FOR VENTILATION) TO HAVE A MINIMUM (BATT) INSULATION OF R-15WALLS, R-30 CEILINGS. 2.BUILDER AND INSULATION INSTALLER ARE TO PROVIDE A CERTIFICATE OF INSTALLATION AND POST IN THE BUILDING IN A CONSPICUOUS LOCATION. 3.INSTALLATION SHALL CONFORM TO TITLE 24 OF THE STATE OF CALIFORNIA ADMINISTRATIVE CODE AND SHALL BE CERTIFIED AS COMPLYING WITH TITLE 24 BY INSULATION INSTALLER. CARPENTRY: 1. WOOD FRAMING: FRAMING REQUIREMENTS SUCH AS NAILING, LET-IN DIAGONAL BRACES, ETC., SHALL BE PER MINIMUM REQUIREMENTS OF THE APPLICABLE LOCAL CODE UNLESS GREATER REQUIREMENTS ARE INDICATED ON PLANS OR SPECIFICATIONS. 2. FRAMING LUMBER: FRAMING LUMBER SHALL BE DOUGLAS FIR LARGE, GRADE MARKED BY W.W.P.A. OR W.C.L.I.B. AS FOLLOWS, UNLESS OTHERWISE NOTED ON PLANS: VERTICAL FRAMING 2" X 4" & 4" X 4" ........................................STANDARD GRADE 2" X 6" AND LARGER .......................................NO. 2 GRADE 6" X 6" AND LARGER .......................................NO. 1 GRADE HORIZONTAL FRAMING 2" X & 4" X .....................................................NO. 2 GRADE 6" X AND LARGER.............................................NO. 1 GRADE 3. MOISTURE CONTENT: MOISTURE CONTENT OF DOUGLAS FIR FRAMING LUMBER SHALL NOT EXCEED 20% IN ADDITION, THE LUMBER SHALL BE AIR DRIED FOR 60 DAYS UNDER ADEQUATE COVER ON THE SITE,OR LUMBER MAY BE USED THAT HAS A MOISTURE CONTENT APPROXIMATELY EQUAL TO THAT WHICH WILL EVENTUALLY BE ATTAINED IN SERVICE. 4.PROTECTION AGAINST DECAY AND TERMITES: A) WOOD EMBEDDED IN THE GROUND OR IN DIRECT CONTACT WITH THE EARTH AND USED FOR THE SUPPORT OF PERMANENT STRUCTURES, SHALL BE TREATED WOOD. B) WOOD JOISTS OR THE BOTTOM OF WOOD FLOORS CLOSER THAN 18 INCHES, OR WOOD GIRDERS CLOSER THAN 12 INCHES TO THE GROUND UNDER FLOOR AREAS AND THEIR SUPPORTS, SHALL BE OF TREATED WOOD OR ALL HEARTWOOD OF APPROVED NATURALLY DURABLE SPECIES AS LISTED IN THE UNIFORM BUILDING CODE APPLICABLE EDITION. 5. EXTERIOR AND BEARING STUD WALL REQUIREMENTS: MAXIMUM HEIGHT: UP TO 10'..............................................................2X4 @ 16"OC UP TO 20'.............................................................2X6 @ 16"OC UP TO 22'..............................................................2X8 @ 16"OC UP TO 24'.....................................2X10 @ 16"OC OR 2X8 @ 8 6. NAILING SCHEDULE: NAILS NAILING CONNECTION BOX OR COMMON POST TO PIER PAD - TOP NAIL .....................3-16D OR 4-SD GIRDER TO POST-TOE NAIL..........................316D OR 4-SD JOIST TO SILL OR GIRDER-TOE NAIL.................3-8D BRIDGING TO JOIST-TOE NAIL.......................2-8D 1 X 6 SUB-FLOOR TO JOIST-FACE NAIL................2-8D PLYWOOD SUB-FLOOR TO JOIST-FACE NAIL..........8D-6"O.C. (U.N.O.) 2-INCH SUB-FLOOR TO JOIST OR GIRDER ............2-16D PLATE TO JOIST OR BLOCKING.......................16D-16" O.C. STUD TO PLATE-END NAIL...........................2-16D STUD TO PLATE-TOE NAIL...........................3-16D OR 4-8D TOP PLATES-SPIKE TOGETHER........................16D OR 16" O.C. -LAPS AND INTERSECTIONS..................2-16D (U.N.O.) CEILING JOISTS TO PLATE TOE NAIL.................2-16D OR 3-8D -LAPS OVER PARTITIONS....................3-16D -TO PARALLEL ALTERNATE RAFTE.............3-16D RAFTER TO PLATE - TOE NAIL.......................2-16D OR 3-8D RAFTER TO RIDGE..................................2-16D OR 3-8D CONTINUOUS 1-INCH BRACE TO STUD..................3-8D 2-INCH CUT - IN BRACE TO STUD....................2-16D 1X6 SHEATHING TO BEARING.........................2-8D 1X8 SHEATHING TO BEARING.........................3-8D *PLYWOOD SHEATHING TO BEARING....................3D-6" O.C. (U.N.O.) CORNER STUDS AND ANGLES..........................16D-24" O.C. 7. NAILS, BOLTS, SCREWS: A) NAILING SHALL BE AS INDICATED ON PLANS AND COMPLY TO CODES HAVING JURISDICTION. BOLTS SHALL HAVE STANDARD B) FASTENERS: 1) ALL CONNECTORS NOTED TO BE SIMPSON OR EQUIVALENT. 2) USE FULL NAILING/BOLTING @ ALL CONNECTIONS U.N.O. 3) ALL NAILS TO BE COMMON U.N.O. 4) ALL BOLTS TO BE MIN ASTM-A307 5) BOLT HOLES: MAX 1/16 IN. LARGER THAN BOLT DIA. 6) ALL BOLTS ON WOOD TO USE M.I. WASHER UNDER HEAD & NUT. 7) LAG BOLTS: LEAD HOLES FOR SHANK TO BE SAME AS SHANK; THREADED PORTION TO BE 60-70% OF SHANK DIA. 8) PLATES, SILLS AND SLEEPERS: A) ALL FOUNDATION PLATES OR SILLS AND SLEEPERS ON A CONCRETE OR MASONRY SLAB, WHICH IS IN DIRECT CONTACT WITH EARTH AND SILLS WHICH REST ON CONCRETE OR MASONRY FOUNDATIONS, SHALL BE TREATED WOOD OR FOUNDATION REDWOOD, ALL MARKED OR BRANDED BY AN APPROVED AGENCY. CUT WASHERS UNLESS OTHERWISE NOTED AND UNLESS USED WITH STEEL PLATES OR ANGLES. HOLES FOR BOLTS SHALL NOT BE MORE THAN 1/16" LARGER THAN BOLT DIAMETER. LAG SCREWS SHALL BE TURNED, NOT DRIVEN, INTO PRE-DRILLED HOLES 2/3 OF THE SHANK DIAMETER. CARPENTRY: (CONTINUED) 15. FLOOR JOISTS: A) (BEARING) EXCEPT WHERE JOISTS ARE SUPPORTED ON A 1-INCH BY 4-INCH RIBBON STRIP AND MAILED TO THE ADJOINING STUD, THE ENDS OF EACH JOIST SHALL HAVE NOT LESS THAN 1-1/2 INCHES OF BEARING ON WOOD OR METAL, NOR LESS THAN 3 INCHES OF MASONRY. B) (BLOCKING) JOISTS SHALL BE SUPPORTED LATERALLY AT THE ENDS AND AT EACH SUPPORT BY SOLID BLOCKING EXCEPT WHERE THE ENDS OF JOISTS ARE MAILED TO A HEADER, BANK OR RIM JOIST OR TO AN ADJOINING OR BY THEIR APPROVED MEANS. SOLID BLOCKING SHALL NOT BE LESS THAN 2 INCHES IN THICKNESS AND THE FULL DEPTH OF JOIST. C) (NOTCHES AND HOLES) NOTCHES ON THE ENDS OF JOISTS SHALL NOT EXCEED ONE-FOURTH THE JOIST DEPTH. HOLES BORED IN JOISTS SHALL NOT BE WITHIN 2 INCHES OF THE TOP OR BOTTOM OF THE JOIST AND THE DIAMETER OF ANY SUCH HOLE SHALL NOT EXCEED ONE-THIRD THE DEPTH OF THE JOIST. NOTCHES IN THE TOP OR BOTTOM OF JOISTS SHALL NOT EXCEED ONE-SIXTH THE DEPTH AND SHALL NOT BE LOCATED IN THE MIDDLE THIRD OF THE SPAN. D) (LAPS) JOISTS FRAMING FROM OPPOSITE SIDES OF A BEAM, GIRDER OR PARTITION SHALL BE LAPPED AT LEAST 4 INCHES OR THE OPPOSING JOISTS SHALL BE TIED TOGETHER IN AN APPROVED MANNER. E) (FRAMING ANCHORS) JOISTS FRAMING INTO THE SIDE OF A WOOD GIRDER SHALL BE SUPPORTED BY FRAMING ANCHORS OR ON LEDGER STRIPS NOT LESS THAN 2 INCHES BY 2 INCHES. F) (FRAMING AROUND OPENINGS) TRIMMER AND HEADER JOISTS WHEN FRAMED AROUND OPENINGS SHALL BE DOUBLED, OR OF LUMBER OF EQUIVALENT CROSS SECTION, WHEN THE SPAN OF THE HEADER EXCEEDS 4 FEET. THE ENDS OF HEADER JOISTS MORE THAN 5 FEET LONG SHALL BE SUPPORTED BY FRAMING ANCHORS OR JOIST HANGERS UNLESS BEARING ON A BEAM, PARTITION OR WALL. TAIL JOISTS OVER 12 FEET LONG SHALL BE SUPPORTED AT HEADER BY FRAMING ANCHORS OR ON LEDGER STRIPS NOT LESS THAN 2 INCHES BY 2 INCHES. G) (SUPPORTING BEARING PARTITIONS) BEARING PARTITIONS PERPENDICULAR TO JOISTS SHALL NOT BE OFFSET FROM SUPPORTING GIRDERS, WALLS OR PARTITIONS MORE THAN THE JOIST DEPTH. JOISTS UNDER AND PARALLEL TO BEARING PARTITIONS SHALL BE DOUBLED. 4.CLOTHES DRYER MOISTURE EXHAUST DUCT SHALL BE 4 INCHES IN DIAMETER AND LENGTH IS LIMITED TO 14 FEET WITH TWO ELBOWS FROM THE CLOTHES DRYER TO POINT OF TERMINATION. DUCT LENGTH SHALL BE REDUCED BY 2 FEET FOR EVERY ELBOW IN EXCESS OF TWO. 5.THE DWELLING SHALL HAVE WATER CLOSETS (TOILETS), WHICH USE NO MORE THAN 1.6 GALLONS PER FLUSH. (P.C. 402.3) 6.WHERE NM CABLE (ROMEX) IS RUN ACROSS THE TOP OF CEILING JOISTS AND/OR WHERE THE ATTIC IS NOT ACCESSIBLE BY PERMANENT STAIRS OR LADDERS, PROTECTION WITHIN 6 FEET OF THE NEAREST EDGE OF THE SCUTTLE HOLE OR ATTIC ENTRANCE SHALL BE PROVIDED. (E.C. 336-6(D), 333-12) 16. ROOF AND CEILING FRAMING: A) (FRAMING) RAFTER SHALL BE FRAMED DIRECTLY OPPOSITE EACH OTHER AT THE RIDGE. THERE SHALL BE A RIDGE BOARD AT LEAST 2-INCHE NOMINAL THICKNESS AT ALL RIDGES AND NOT LESS IN DEPTH THAN THE CUT END OF THE RAFTER. AT ALL VALLEYS AND HIPS THERE SHALL BE A SINGLE VALLEY OR HOP RAFTER NOT LESS THAN 2 INCHES NOMINAL THICKNESS AND NOT LESS IN DEPTH THAN THE CUT END OF THE RAFTER. B) (RAFTER TIES) RAFTERS SHALL BE NAILED TO ADJACENT CEILING JOISTS TO FORM A CONTINUOUS TIE BETWEEN EXTERIOR WALLS WHEN SUCH JOISTS ARE PARALLEL TO THE RAFTERS. WHERE NOT PARALLEL, RAFTERS SHALL BE TIED TO 1-INCH THICK BY 4-INCH (NOMINAL) MINIMUM SIZED CROSS TIES. RAFTER TIES SHALL BE SPACED NOT MORE THAN 4 FEET ON CENTER. C) (PURLING) PURLING TO SUPPORT ROOF LOADS MAY BE INSTALLED TO REDUCE THE SPAN OF RAFTERS WITHIN ALLOWABLE LIMITS AND SHALL BE SUPPORTED BY STRUTS TO BEARING WALLS. THE MAXIMUM SPAN OF 2-INCH BY4-INCH PURLING SHALL BE 4 FEET. THE MAXIMUM SPAN OF THE 2-INCH BY 6-INCH PURLING SHALL BE 5 FEET BUT IN NO CASE SHALL THE PURLING BE SMALLER THAN THE SUPPORTED RAFTER. STRUTS SHALL BE NOT SMALLER THAN 2-INCH BY 4 INCH MEMBERS. THE EMBRACED LENGTH OF STRUTS SHALL NOT EXCEED 8 FEET AND THE MINIMUM SLOPE OF THE STRUTS SHALL BE NOT LESS THAN 45" FROM THE HORIZONTAL. 7.ALL ANCHOR BOLTS, DOWELS AND OTHER INSERTS SHALL BE PLACED BEFORE POURING CONCRETE. 8.REINFORCING STEEL: ASTM 4615, GRAD 40, LAP BARS 40 DIAMETERS AT CORNERS AND SPLICES. 9.COVER FOR REINFORCING BARS: 3" WHERE DEPOSITED AGAINST EARTH, 2" WHERE EXPOSED TO EARTH AND PLACED IN FORMS. 10.CURING, SURFACES KEPT CONTINUOUSLY WET NOT LESS THAN 7 DAYS AFTER POURING. MECHANICAL/PLUMBING/ELECTRICAL CODE REQUIREMENTS 1.THE FOLLOWING ARE REQUIRED FOR THE FORCED AIR FURNACE IN A COMPARTMENT: a. COMPARTMENT DIMENSIONS SHALL HAVE 3" MINIMUM CLEARANCE ON SIDES, BACK, AND TOP, AND 6" MINIMUM CLEARANCE ALONG THE COMBUSTION CHAMBER OPENING SIDE OF THE FURNACE. THE MINIMUM WIDTH PERMITTED IS 12" GREATER THAN THE EQUIPMENT. (M.C. 9041 & 904.7) b. AREA OF COMBUSTION AIR OPENINGS OF 1 SQ. INCH PER 1,000 BTU (100 SQ. INCH MINIMUM) IS REQUIRED INTO THE COMPARTMENT. HALF OF AREA WITHIN 12 INCHES OF CEILING AND HALF WITHIN 12 INCHES OF FLOOR.(M.C. 701, 702, 707, & T 7-1) c. COMBUSTI8ON AIR FROM THE ATTIC THROUGH 26 GAUGE GALVANIZED STEEL SLEEVE EXTENDING 6 INCHES MINIMUM ABOVE CEILING JOISTS WITHOUT A SCREEN AT THE TOP (ATTIC TO HAVE ADEQUATE OPENINGS). (M.C. 703.1.2.3) d. COMBUSTION AIR FROM OUTSIDE TO COMPARTMENT WITH A ¼" SCREEN AT OUTSIDE OPENING. (M.C. 702.3) e. SEPARATE DUCTS FOR UPPER AND LOWER COMBUSTION AIR SUPPLY OPENINGS. (M.C. 704.1.6) 9. COLUMNS AND POSTS: A) ALL WOOD COLUMNS AND POSTS SHALL BE FRAMED TO TRUE END BEARINGS. SUPPORTS SHALL BE DESIGNED TO HOLD THE COLUMN OR POST SECURELY IN POSITION AND TO PROTECT ITS BASE FROM DETERIORATION. IN AREAS EXPOSED TO WATER SPLASH AND IN EXTERIOR LOCATIONS, WOOD COLUMNS AND POSTS SHALL BE SUPPORTED BY PIERS PROJECTING AT LEAST 2 INCHES ABOVE THE FINISHED FLOOR AND SHALL BEAR ON A METAL BASE PLATE OR A FOUNDATION PLATE OR SILL. POSTS OR COLUMNS OF TREATED WOOD OR OF FOUNDATION GRADE REDWOOD OR CEDAR MAYBE PLACED DIRECTLY ON CONCRETE, SOLID MASONRY OR GROUTED MASONRY. 10. WOOD AND EARTH SEPARATION: A) NO UNTREATED WOOD EXCEPT FOUNDATION REDWOOD SHALL BE NEARER THAN 6 INCHES TO ANY EARTH UNLESS SEPARATED BY CONCRETE AT LEAST 3 INCHES IN THICKNESS WITH AN IMPERVIOUS MEMBRANE INSTALLED BETWEEN THE EARTH AND CONCRETE. 11. ROOF SHEATHING: A) 1X4 OR 1X6 SPACED; WITH 1X6 SHIP LAP STARTER BOARD AT ALL EXPOSED RAVES (RE SAWN FACE DOWN); SHALL BE STANDARD, 3 COMMON, NO. 2 OR CONSTRUCTION GRADES AND SHALL BE SPACED NO MORE THAN 6" CLEAR. D) (BLOCKING) RAFTERS MORE THAN 8 INCHES IN DEPTH SHALL BE SUPPORTED LATERALLY AT THE ENDS AND AT EACH SUPPORT BY SOLID BLOCKING NOT LESS THAN 2 INCHES IN THICKNESS AND THE FULL DEPTH OF THE RAFTER UNLESS MAILED TO A HEADER; BAND OR RIM JOIST OR TO AN ADJOINING STUD. 17. WALL FRAMING: A) (SIZE) STUDS IN EXTERIOR WALLS AND INTERIOR BEARING WALLS OF BUILDINGS NOT MORE THAN TWO STORIES IN HEIGHT SHALL BE NOT LESS THAN 2 INCHES BY 4 INCHES IN SIZE. FOR THREE-STORY BUILDINGS SUCH STUDS SHALL BE NOT LESS THAN 3 INCHES BY 4 INCHES OR 2 INCHES BY 6 INCHES TO THE BOTTOM OF THE SECOND FLOOR JOISTS, AND 2 INCHES BY 4 INCHES FOR THE TWO UPPER STORIES. INTERIOR NONBEARING PARTITIONS MAY BE FRAMED WITH 2-INCH BY 4 INCH STUDS. B) (HEIGHT) UNLESS, SUPPORTED LATERALLY BY ADEQUATE FRAMING, THE MAXIMUM ALLOWABLE HEIGHT FOR STUDS SHALL BE 14 FEET FOR 2-INCH BY 4-INCH STUDS; AND 20 FEET FOR 2-INCH BY 6 INCH. C) (SPACING) STUDS SUPPORTING FLOORS AND CEILINGS OR RAFTERS SHALL BE SPACED NOT MORE THAN 16 INCHES. D) (CRIPPLE WALLS) CRIPPLE WALLS SHALL BE FRAMED OF STUDS NOT LESS IN SIZE THAN THE STUDDING ABOVE WITH A MINIMUM LENGTH OF 24 INCHES, OR SHALL BE FRAMED OF SOLID BLOCKING. WHEN EXCEEDING 4 FEET IN HEIGHT, SUCH WALLS SHALL BE FRAMED OF STUDS HAVING THE SIZE REQUIRED FOR AN ADDITIONAL STORY. E) (HEADERS) HEADERS FOR ALL OPENINGS 4 FEET WIDE OR LESS IN BEARING WALLS SHALL BE PROVIDED WITH HEADERS CONSISTING OF EITHER TWO PIECES OF2-INCH FRAMING LUMBER PLACED ON EDGE AND SECURELY FASTENED TOGETHER OR 4-INCH LUMBER OF EQUIVALENT CROSS SECTION. ALL OPENINGS MORE THAN 4 FEET WIDE SHALL BE PROVIDED WITH HEADERS OR LINTELS. SUCH HEADERS OR LINTELS SHALL HAVE NOT LESS THAN 2-INCH SOLID BEARING AT EACH END TO THE FLOOR OR BOTTOM PLATE, UNLESS OTHER APPROVED FRAMING METHODS OR JOINT DEVICES ARE USED. SEE PLAN FOR SIZE. F) (PIPES IN WALLS) STUD PARTITIONS CONTAINING PLUMBING, HEATING, OR OTHER PIPES SHALL BE SO FRAMED AND THE JOISTS UNDERNEATH SO SPACED AS TO GIVE PROPER CLEARANCE FOR THE PIPING, WHERE A PARTITION CONTAINING SUCH PIPING RUNS PARALLEL TO THE FLOOR JOISTS, THE JOISTS UNDERNEATH SUCH PARTITIONS SHALL BE DOUBLED AND SPACED TO PERMIT THE PASSAGE OF SUCH PIPES AND SHALL BE BRIDGED, WHERE PLUMBING, HEATING OR OTHER PIPES ARE PLACED IN OR PARTLY IN A PARTITION, NECESSITATING THE CUTTING OF THE HOLES OR PLATES.A METAL TIE NOT LESS THAN 1/8 INCH THICK AND 1-1/2 INCHES WIDE SHALL BE FASTENED TO THE PLATE ACROSS AND TO EACH SIDE OF THE OPENING WITH NOT LESS THAN FOUR 160 NAILS. FINISHES: A. EXTERIOR PLASTER: 1) PLASTER: EXTERIOR PLASTER SHALL BE PORTLAND CEMENT PLASTER WITH FINISH AS INDICATED ON EXTERIOR ELEVATIONS. 2)BASE COATS:THE MIX SHALL CONSIST OF ONE PART PORTLAND CEMENT TO NOT MORE THAN 3-1/2 PARTS SAND FOR FIRST SCRATCH COAT AND NOT MORE THAN 4 PARTS SAND FOR THE TEXTURED BROWN COAT. ALL MEASURED BY VOLUME TO WHICH MAY BE ADDED NOT MORE THAN 10% OF HYDRATED LIME, MIXED WITH WATER IN A BATCH MIXER TO THE PROPER CONSISTENCY. 3)PLASTER THICKNESS: STEP 1 - SCRATCH COAT - 1/4" THICK STEP 2 - TEXTURED BROWN COAT - 3/8" THICK STEP 3 - SMOOTH FINISH COAT -1/4" THICK ON 34# METAL LATH AND 15# PELT. TEXTURED BROWN COAT IS TO HAVE AN UNEVEN BUT SMOOTH FINISH WITH NO TROWEL MARKS TO BE VISIBLE. PROVIDE SAMPLE TO BE APPROVED BEFORE PROCEEDING. SMOOTH FINISH COAT TO BE PAINTED USING 20-30 SILICA SAND FOR SMOOTH HAND APPLIED LOOK. PROVIDE SAMPLE 10' X 10' AREA TO BE APPROVED. 4)ALL EXTERIOR PLASTER SHALL CONFORM TO CHAPTER 47, U.B.C. B. INTERIOR PLASTER: 1) GYPSUM PLASTER - 3/8" GYPSUM LATH WITH ½" TWO COAT PLASTER OVER THE CORNER BEADS, CASING BEADS AND REINFORCEMENT AT OPENINGS. C. GYPSUM WALLBOARD: 1) ASTM C36 5/8" THICK, WITH TAPERED EDGES, REGULAR AND TYPE X AT 1 HOUR RATED WALLS. (U.N.O.) D. PAINTING: 1) GENERAL - APPLY 1 COAT PRIMER, 2 COAT PAINT, TYPICAL UNLESS NOTED OTHERWISE. 2)PAINT SHALL BE SHERWIN-WILLIAMS, W.P. FULLER, DUNN EDWARDS OR SINCLAIR. G) (BRIDGING) ALL STUD PARTITIONS OR WALLS WITH STUDS HAVING A HEIGHT TO LEAST THICKNESS RATIO EXCEEDING 50 SHALL HAVE BRIDGING NOT LESS THAN 2 INCHES IN THICKNESS AND OF THE SAME WIDTH AS THE STUDS FITTED SNUGLY AND NAILED THERE TO PROVIDE ADEQUATE LATERAL SUPPORT, UNLESS COVERED BY INTERIOR OR EXTERIOR WALL COVERING OR SHEATHING MEETING THE MINIMUM REQUIREMENT OF THE UNIFORM BUILDING CODE APPLICABLE EDITION. H) (CUTTING AND NOTCHING) IN EXTERIOR WALLS AND BEARING PARTITIONS, ANY WOOD STUD MAY BE CUT OR NOTCHED TO A DEPTH NOT EXCEEDING 25 PERCENT OF ITS WIDTH, CUTTING OR NOTCHING OF STUDS TO A DEPTH NOT GREATER THAN 40 PERCENT OF THE WIDTH OF THE STUD IS PERMITTED IN NONBEARING PARTITION SUPPORTING NO LOADS OTHER THAN THE WEIGHT OF THE PARTITION. I) (BORED HOLES) A HOLE NOT GREATER IN DIAMETER THAN 40 PERCENT OF THE STUD MAY BE BORED IN ANY WOOD STUD. BORED HOLES NOT GREATER THAN 60 PERCENT OF THE WIDTH OF THE STUD ARE PERMITTED IN NONBEARING PARTITION OR IN ANY WALL WHERE EACH BORED STUD IS DOUBLED PROVIDED NOT MORE THAN TWO SUCH SUCCESSIVE DOUBLED STUDS ARE SO BORED. IN NO CASE SHALL THE EDGE OF THE BORED HOLE BE NEARER THAN 5/8 INCH TO THE EDGE OF THE STUD. BORED HOLES SHALL NOT BE LOCATED AT THE SAME SECTION OF THE STUD AS A CUT OR NOTCH J) ROUGH WINDOW SILLS OVER 8 FEET IN LENGTH SHALL BE DOUBLED. K) BLOCKING TO BE PROVIDED AT ALL HANDRAILS. ENERGY: A.BUILDING ENVELOPE: 1) DOORS AND WINDOWS BETWEEN CONDITIONED AND UNCONDITIONED SPACE MUST BE FULLY WEATHER-STRIPPED. 2)THE FOLLOWING OPENINGS IN THE BUILDING ENVELOPE SHALL BE CAULKED OR SEALED: A) EXTERIOR JOINTS AROUND WINDOW AND DOOR FRAMES. B) BETWEEN EXTERIOR WALL SOLE PLATES AND FLOORS AND BETWEEN EXTERIOR WALL PANELS. C) PENETRATIONS IN WALLS, CEILINGS, AND FLOORS FOR PLUMBING AND ELECTRICAL DISTRIBUTION SYSTEMS. D) OPENINGS IN ATTIC FLOORS. E) ALL OTHER OPENINGS IN THE BUILDING ENVELOPE. 3) MANUFACTURED DOORS AND WINDOWS MUST BE LABELED AND CERTIFIED PER ANSI, AAMA, NWMA, FHDA, OR ASTM STANDARDS. 4) EXHAUST FANS SHALL BACK DRAFT OR AUTOMATIC DAMPERS. 2.THE FOLLOWING ARE REQUIRED FOR FURNACE OR COMFORT COOLING EQUIPMENT IN AN ATTIC: a. SCUTTLE 22"X30" OR THE SIZE OF THE LARGEST PIECE OF EQUIPMENT AND LOCATED NOT OVER 20 FEET FROM EQUIPMENT IS REQUIRED. (M.C. 908) b. 24 INCHES WIDE UNOBSTRUCTED PASSAGEWAY OF SOLID CONTINUOUS FLOORING FROM SCUTTLE TO EQUIPMENT AND ITS CONTROLS. (M.C. 908) c. UNOBSTRUCTED WORKSPACE OF 30" MIN. DEPTH IN FRONT OF EQUIPMENT. (M.C.908) d. LIGHT OVER EQUIPMENT WITH A SWITCH AT THE SCUTTLE. (M.C. 908) e. VENT THROUGH THE ROOF A MIN OF 5 FEET ABOVE THE HIGHEST VENT COLLAR, WHICH IT SERVES. (M.C. 806.2) f. FURNACE INSTALLATION SHALL MEET ALL LISTED CLEARANCE. (M.C. 304) 3. CLOTHES DRYER MOISTURE EXHAUST DUCT SHALL TERMINATE ON THE OUTSIDE OF THE BUILDING AND SHALL BE EQUIPPED WITH A BACK-DRAFT DAMPER (NOT IN CRAWL SPACES OR IN ATTIC AREAS). (M.C. 504.3) B) PLYWOOD SHEATHING IS TO BE CONTINUOUS OVER TWO OR MORE SPANS AND IS TO BE MINIMUM 1/2" THICK AND HAVE PANEL IDENTIFICATION INDEX AS REQUIRED FOR RAFTER SPACING (SEE PLANS); ALL SHALL BE STRUCTURAL AND II, STANDARD SHEATHING, AND C-D GRADES ONLY. 12. FLOOR SHEATHING: A) PLYWOOD COMBINATION SUB-FLOOR UNDER-LAYMENT SHEATHING CONTINUOUS OVER TWO OR MORE SPANS SHALL BE MINIMUM 5/8" THICK TONGUE-AND GROOVE AND SPACING (SEE PLANS) AND SHALL BE UNDER-LAYMENT GRADE, C-C (PLUGGED) AND ALL GRADES OF SANDED EXTERIOR TYPE PLYWOOD IN GROUP SPECIES OF 1, 2, OR 3, WHERE FLOOR JOISTS SPACING IS 48"O/C USE 1-1/8" THICK TONGUE-AND-GROOVE 2-4-1 (EXTERIOR GLUE) PLYWOOD IN GROUP SPECIES OF 1, 2, OR 3. 13. FRAMING PRACTICES: A) WORKMANSHIP: 1) ALL MEMBERS SHALL BE FRAMED, ANCHORED, TIED, AND BRACED SO AS TO DEVELOP THE STRENGTH AND RIGIDITY NECESSARY FOR THE PURPOSES FOR WHICH THEY ARE USED. B) BEAMS AND GIRDERS: 1) THE ENDS OF BEAMS OR GIRDERS SUPPORTED ON MASONRY OR CONCRETE SHALL HAVE NOT LESS THAN 4 INCHES OF BEARING. HEATING: 1. HEATING AND VENTILATING: A) MATERIALS: 1) PROVIDE 48 SQ. IN. DUCT THROUGH ROOF OR WALL TO OUTSIDE AIR FOR VENT OVER KITCHEN RANGE. 2) ALL BATHROOM AND LAUNDRIES WITHOUT WINDOWS SHALL BE PROVIDED WITH AN CAPABLE OF FIVE AIR CHANGES EVERY HOUR. 3) FORCED-AIR FURNACES SHALL BE PROVIDED WITH HIGH AND LOW COMBUSTION AIR FROM OUTSIDE AIR WHEN LOCATED IN COMPARTMENT WITHIN THE DWELLING UNIT. 4) DELETED. 5) FORCED-AIR FURNACES SHALL HAVE SUMMER SWITCH WITH 30% FRESH OUTSIDE AI INTAKE. 5)MASONRY AND FACTORY-BUILT FIREPLACES SHALL HAVE THE FOLLOWING: A)TIGHT FITTING CLOSEABLE METAL OR GLASS DOORS COVERING THE ENTIRE OPENING OF THE FIREBOX. B)A COMBUSTION AIR INTAKE TO DRAW AIR FROM OUTSIDE THE BUILDING DIRECTLY INTO FIREBOX, WHICH IS AT LEAST SIX SQUARE INCHES IN AREA AND IS EQUIPPED WITH A READILY ACCESSIBLE, OPEN ABLE, AND TIGHT FITTING DAMPER. APPLIES TO EXTERIOR WALLS ONLY. MASONRY: 1.CONCRETE MASONRY LIMITS: UNLESS OTHER WISE NOTED ON THE ARCHITECTURAL OR STRUCTURAL DRAWINGS, CONCRETE MASONRY SHALL BE C 90 "FOLLOW CONCRETE MASONRY UNITS". LATEST REVISION. 2.MINIMUM COMPRESSIVE STRENGTH 2000 PSI AT 28 DAYS. COLOR TO BE AS NOTED ON THE ARCHITECTURAL DRAWINGS AND APPROVED BY THE ARCHITECT AND OWNER FROM SAMPLES SUBMITTED BY CONTRACTOR PRIOR TO INSTALLATION. 3.PORTLAND CEMENT: LOW ALKALI AND CONFORMING TO ASTM C 15, TYPE II. 4.MOTOR SAND: ASTM C 144, NOT LESS THAN 4% PASSING NO. 100 SIEVE, UNIFORMLY GRADED. 5.GROUT SAND: ASTM C 404, NATURAL, SIZE NO 1. 6.PEA GRAVEL: ASTM C 404, GRAVEL, EXCEPT MAXIMUM 5% PASSING. 2) ALL BEAM OR GIRDERS SUPPORTED ON WOOD SHALL HAVE FULL BEARING AND BEARING SHALL BE COMPRISED OF ONE (1) SOLID SUPPORT OR A BUILT-UP SUPPORT CONSTRUCTED IN AN APPROVED MANNER UNLESS OTHERWISE SPECIFIED ON PLANS. 14. BALLOON FRAME TABLE: A) (1) 2 X 4 AT 16" O/C 14'-0" MAX. LATERALLY UNSUPPORTED HEIGHT B) (2) 2 X 4 AT 16" O/C 16'-0 MAX. LATERALLY UNSUPPORTED HEIGHT C) (3) 2 X 4 AT 16" O/C 18'-0 MAX LATERALLY UNSUPPORTED HEIGHT D) (4) 2 X 4 AT 16" O/C 20'-0 MAX LATERALLY UNSUPPORTED HEIGHT E) (1) 2 X 6 AT 16" O/C 20'-0 MAX LATERALLY UNSUPPORTED HEIGHT * W.C.D.F. NO. 2 OR BETTER AND NAIL WITH 16D AT 24" O/C C) TIGHT FITTING FLUE DAMPER WITH A READILY ACCESSIBLE CONTROL. D) CONTINUOUS BURNING PILOT IS PROHIBITED. 6) CONTRACTOR SHALL POST INSULATION COMPLIANCE CARD IN A CONSPICUOUS LOCATION ON THE JOB SITE. This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer GENERAL NOTES SHEET TITLE REVISIONS designs thereby are and shall remain the property of F. Solis (Draftsman) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F. Solis, visual contact of acceptance of these restrictions. Sheet A2 AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 LCMAGNOLIA PL PLPL PL (E) GRASS (E) CONCRETE PATIO (E) MAIN STRUCTURE 1364 SQFT (E) DRIVE WAY (E) FRONT YARD (E) STORAGE SHED 90 SQFT WH (N) UNIT 2 558 SQFT (E ) FL O W SL O P E (E) FLO W S L OPE(E) FL O W SL O P E (E ) FL OW SL O P E (E ) FL OW SL O P E This Gra i s,s ecificati s a G iGeas, ith these Gra i s shall c stit te e iGe ce Disclaimer FRONT PAGE PLOT PLAN VICINITY MAP SHEET TITLE REVISIONS Gesi s there are a G shall remai the r ert f F. SOLIS (Desi er) a G art there f shall e c ieG Giscl seG t thers r seG i c ecti ith a r r r ect f r hich there ha e ee re areG a G Ge el eG, ith t the the ritte c se t f F.SOLIS, is al c tact f acce ta ce f these restricti s. Sheet A-1 VICINITY MAP PROJECT LOCATION PROJECT SITE DATA DESCRIPTION: 360 SQ.FT. ADU. (R-3) TYPE OF CONSTRUCTION: V-B ZONING : RSFR BUILDING SPRINKLERS : NO ADU TO MATCH BUILDING SQUARE FOOTAGE: LOT AREA : +/- .25 AC. (E) GARAGE : 360 SQ.FT NEW ADDITION : 153 SQ.FT. NEW ADU PORCH : 48 SQ.FT. ADU CONVERSION : 561 SQFT. ASSESSOR'S PARCEL NO.: 013-012-28 LOT NUMBER - 20 / B INDEXSHEET FRONT PAGE, PROPOSED PLOT PLAN, VICINITY MAP EROSION CONTROL PLAN ORDINANCE FORMS GENERAL NOTES PROPOSED ADU UTILITY PLAN. DEMO FLOOR PLAN FLOOR PLAN EXISTING ROOF PLAN ELEVATIONS. ICC-REPORT FOR ROOFING MATERIALS ICC - REPORT FOR ROOFING MATERIALS CALIFORNIA GREEN SHEET CALIFORNIA GREEN SHEET DETAILS ADA CLEARANCE DETAILS STRUCTURAL SHEET STRUCTURAL SHEET STRUCTURAL SHEET STRUCTURAL SHEET TITLE 24 TITLE 24 TITLE 24 00-A-1 04-A-1.1 00-A-1.2 00-A-2 01-A-2.1 01-A-2.2 01-A-2.3 01-A-3 01-A-4 01-A-5 01-A-6 03-A-7 03-A-8 01-AS-2 01-AS-3 02-S1.0 02-S2.0 02-S2.1 02-S3.0 03-T-1 03-T-2 03-T-3 PROJECT CODE REQUIREMENTS LEGAL JURISDICTION: CITY OF SANTA ANA THE DESIGN AND CONSTRUCTION OF THIS STRUCTURE SHALL BE IN FULL COMPLIANCE WITH 2022 CALIFORNIA BUILDING CODE WITH ORANGE COUNTY AMENDMENTS 2022 CALIFORNIA RESIDENTIAL CODE 2022 CALIFORNIA MECHANICAL CODE 2022 CALIFORNIA ELECTRICAL CODE 2022 CALIFORNIA PLUMBING CODE 2022 CALIFORNIA ENERGY CODE 2022 ORANGE COUNTY FIRE CODE 2022 ORANGE COUNTY GREEN BUILDING STANDARDS CODE 2022 CFC 2022 OC CO PC NEW ADU CONVERTION EXISTING STRUCTURE PROPERTY OWNER INFORMATION SCOPE OF WORK: -DEMO EXISTING GARAGE DOOR -NEW BATHROOM -NEW KITCHEN/LIVING AREA -NEW STUCCO TO MATCH EXISTING -NEW WINDOWS/DOORS -NEW ADDITION AT GARAGE TO CREATE ADU. -NEW PORCH AT NEW ADU. SC A L E NO T T O 0 8'16' 24' Scale: 3/32" = 1'-0" (E) LANDSCAPE (E) PAVED DRIVEWAY / WALKWAY 1. LOT AREA - 6,700.00 SQFT. 2. EXISTING HOUSE AREA - 1,364.00 SQFT 3. (E) GARAGE - 360.0 SQFT 4. PROPOSED ADU - 558.0 SQFT 5. TOTAL COVER AREA - 1,596.0 SQFT 6. % COVER AREA - 21.05 % 7. % OPEN AREA - 79.95 % SUMMARY NANCY MARIN (714) 270-1755 ADDRESS : 1123 MAGNOLIA AVE, SANTA ANA,CA 92707 AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 PATH OF TRAVEL 1 PLAN CHECK 10.08.24NOTES: DIG ALERT (811) IS TO BE CONTACTED AND COMPLIANCE WITH EXCAVATION SAFETY IN ACCORDANCE WITH GOVERNMENT CODE 4216 PRIOR TO ANY EXCAVATION TAKING PLACE. 1 1 1 1 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1 1 EXISTING OVERHEAD POWER LINES. 1 1 1 NOTES: ADU sf / SFD (510 sf / 1364 sf = 38% THE ADU sf/SFD sf RATIO IS FOR PARK & REC FEE PURPOSE ONLY. THE APPLICANT IS RESPONSIBLE FOR THE GIVEN "SFR sf" OF THE EXISTING PRIMARY RESIDENCE; BUILDING SAFETY STAFF ARE NOT RESPONSIBLE FOR THE ACCURACY OF THE GIVEN "SFR sf" OF THE EXISTING RESIDENCE. 2 2 PLAN CHECK 11.18.24 NOTES: FOR NEW BUILDING AND ADDITIONS, ALTERATIONS, AND REPAIRS WITHIN ANY TWELVE-MONTH PERIOD EXCEED FIFTY (50%) PERCENT OF THE VALUE OF ANY EXISTING BUILDING OR STRUCTURE, EACH BUILDING OR STRUCTURE SHALL BE MADE TO CONFORM TO THE REQUIREMENTS FOR NEW BUILDINGS OR STRUCTURES AND COMPLY WITH THE BUILDING SECURITY REGULATIONS. SANTA ANA MUNICIPAL CODE CHAPTER 8, DIVISION 3. 2 Bldg #102120229 APPROVALS: PLNG - C. Santana BLDG - CSG POLICE - B. Martin PUBLIC WORKS - Y. Soto 1123 S Magnolia Ave Unit# 22/19/2025 5 3 4 1 2 D C B A E 6 7 8 Contractor or Builder shall be responsible for checking and verifying all dimensions and sizes shown on these drawings prior to construction. SMOKE ALARM SHALL BE INTERCONNECTED HARD-WIRED WITH BATTERY BACKUP AND SHALL BE INSTALLED IN ACCORDANCE WITH NFPA 72. BATTERY SMOKE ALARM PERMITTED IN EXISTING BUILDINGS WHERE NO CONSTRUCTION IS TAKING PLACE. SMOKE ALARMS SHALL BE TESTED & MAINTAINED IN ACCORDANCE WITH MANUFACTURED INSTRUCTIONS. SMOKE ALARMS SHALL BE REPLACED AFTER 10 YEARS FROM THE DATE OF MANUFACTURED MARKED ON THE UNIT. CONVENTIONAL IONIZATION SMOKE ALARMS THAT ARE SOLELY BATTERY POWERED SHALL BE EQUIPPED WITH A 10 YEAR BATTERY AND HAVE A SILENCE FEATURE. CARBON MONOXIDE ALARM SHALL BE INTERCONNECTED HARD-WIRE WITH BATTERY BACKUP THERMOSTAT ELECTRICAL CHARGING VEHICLE INSTALLED PER ORANGE COUNTY ELECTRICAL CODE HVAC SUPPLY GRILLE. HVAC RETURN GRILLE. C * PEDESTRIANS SHALL BE PROTECTED DURING CONSTRUCTION, REMODELING AND DEMOLITION ACTIVITIES AS REQUIRED BY COUNTY OF LOS ANGELES BUILDING CODE CHAPTER 33. * ANNULAR SPACES AROUND PIPES, ELECTRIC CABLES,CONDUITS OR OTHER OPENINGS IN SOLE/BOTTOM PLATES AT EXTERIOR WALLS SHALL BE PROTECTED AGAINST THE PASSAGE OF RODENTS BY CLOSING SUCH OPENINGS WITH CEMENT MORTAR, CONCRETE MASONRY OR SIMILAR METHODS. NOTE: A) The person in charge of the construction or installation, who is eligible under Division 3 of the Business and Professions Code to accept responsibility for the construction or installation of regulated manufactured devices shall post, or make available with the building permit(s) issued for the building, the Certificate of Installation documentation for manufactured devices regulated by the Appliance Efficiency Regulations or Part 6. Such Certificate of Installation documentation shall be made available to the enforcement agency for all applicable inspections. These certificates shall: i. Identify features, materials, components, or manufactured devices, and system diagnostic results required to verify compliance with the Appliance Efficiency Regulations and Part 6 ii. State the number of the building permit under which the construction or installation C80was performed. Sections of the certificate(s), for which submittal to a HERS provider data registry is required, shall display the unique registration number assigned by the HERS data registry. iii. Include a declaration statement indicating that the constructed or installed features, materials, components, or manufactured devices conform to all applicable codes and regulations, and to the requirements for such devices given in the plans and specifications approved by the local enforcement agency. iv. Be signed by the documentation author to certify the documentation is accurate and complete. v. Be signed by the individual eligible under Division 3 of the Business and Professions Code to accept responsibility for construction, or installation in the applicable classification for the scope of work specified on the Certificate of Installation document(s). 2) Operating information. The appropriate Certificate(s) of Compliance and a list of the features, materials, components, and mechanical devices installed in the building and instructions on how to operate them correctly and efficiently. 3) Maintenance information. Required routine maintenance actions shall be clearly stated and incorporated on a readily accessible label. The label may be limited to identifying the operation and maintenance manual. 4) Ventilation Information. A description of the quantity of outdoor air that the ventilation system is designed to provide to the building conditioned space, and instructions for proper operation and maintenance. C) The Enforcement agency shall not issue a Certificate of Occupancy until all required Certificates of Verification are posted and made available to the building department for all applicable inspections, and that all Certificates of Verification conform to the specifications of Section 10-103(a)5. B) The builder shall provide the building owner or the person(s) responsible for operation and maintenance of the feature, material, component or mechanical device installed (in case of multi-tenant or centrally operated buildings) with the following at the time of occupancy: 1) Compliance information. The appropriate completed and signed Certificate(s) of Compliance, Certificate(s) of Installation, and if applicable Certificate(s) of Verification documentation submitted. ADMINISTRATIVE REQUIREMENTS NOTES: ELECTRICAL SYMBOLS LIGHT SWITCH SWITCH W/ VACANCY SENSOR DIMMER SWITCH OR MANUAL-ON OCCUPANT SENSOR THREE WAY SWITCH EXHAUST FAN W/HIGH EFFICACY LIGHT (50CFM) 110 VOLT WATER PROOF OUTLET WITH GFCI 110 VOLT OUTLET WITH GFCI 110 VOLT OUTLET WITH ARC-FAULT CIRCUIT AND TEMPERED RESISTANT UNLOCKING TYPE 12VOLT; 15- AND 20 AMPERE (SHALL BE LISTED TEMPERED RESISTANT) HIGH EFFICACY LIGHT FIXTURE HIGH EFFICACY RECESSED LIGHT FIXTURE HIGH EFFICACY OR MOTION SENSOR CONTROLLED LIGHT FIXTURE WITH INTEGRAL PHOTO CONTROL HIGH EFFICACY FLUORESCENT FIXTURE CEILING FAN W/HIGH EFFICACY LIGHT THIS FAN IS TO BE USED FOR WHOLE BUILDING VENTILATION, MINIMUM 68.89 CFM FAN TESTED AT A STATIC PRESSURE OF .25 WC AND RATED @ 1 ZONE OR LESS REQUIRED TO BE INSTALLED. FAN MUST BE ATTACHED TO A MINIMUM 5" DUCT AND NO LONGER THAN 70', SUBTRACT 15' OF ALLOWED LENGTH FOR EACH ELBOW. NOTE 1: PLUMBING FIXTURES FLOW RATES FIXTURE FLOW RATES WATER CLOSET URINALS SINGLE SHOWERHEAD 1.28 GALLONS PER FLUSH LAVATORY FAUCETS 0.5 GALLONS PER FLUSH 2.0 GPM @ 80 PSI FOR ALL COMBINED SHOWERHEADSMULTIPLE SHOWERHEAD 2.0 GALLONS PER MINUTE @ 80 PSI 1.5 GPM @ 60 PSI LAVATORY FAUCETS IN PUBLIC USE AREAS 0.5 GPM @ 60 PSI METERING FAUCETS KITCHEN FAUCETS 0.25 GALLONS PER CYCLE 1.8 GPM @ 60 PSI T NOTE: EXTERIOR GLAZING SHALL BE MULTI-PANE UNITS WITH A MINIMUM OF ONE TEMPERED PANE, OR GLASS BLOCK UNITS, OR MINIMUM 20-MIN. RATED OR COMPLIES WITH SFM 12-7A-2 (708A;R327.8.2.1) NOTE #1 ALL EXTERIOR DOORS SHALL MEET ONE OF THE FOLLOWINGS: A: NONCOMBUSTIBLE MATERIAL OR B: IGNITION-RESISTANT MATERIAL OR C: SOLID CORE WOOD HAVING STILES AND RAILS NOT LESS THAN 1-3/8 IN. THICK WITH INTERIOR PANEL THICKNESS NOT LESS THAN 1-1/4 IN. THICK OR D: MINIMUM 20 MIN. RATED OR E: COMPLIES WITH SFM 12-7A-1 (708A;R327.8) * PROVIDE A WHOLE HOUSE FAN (WHF) THAT IS LISTED IN THE APPLIANCE EFFICIENCY DIRECTORY AND COMPLIES WITH THE FOLLOWING: 1: HAVE INSTALLED ONE OR MORE WHFS WHOSE TOTAL AIR FLOW CFM AS LISTED IN THE CEC DIRECTORY IS AT LEAST 2 CFM/FT2 OF CONDITIONED FLOOR AREA; AND 2: HAVE AT LEAST 1 SQUARE FOOT OF ATTIC VENT FREE AREA FOR EACH 375 CFM OF RATED WHOLE HOUSE FAN AIR FLOW CFM; AND 3: PROVIDE HOMEOWNERS WHO HAVE WHFS WITH A ONE PAGE "HOW TO OPERATE YOUR WHOLE HOUSE FAN" INFORMATIONAL SHEET. EXHAUST FAN NOTE: SHOWER BATHTUB NOTE: * A CIRCULATING AIR SUPPLY OPENING OR DUCT OF 2 SQ. IN. PER 1,000 BTU IS REQUIRED FOR THE FORCED AIR FURNACE. (MC.504.3) * CLOTHES DRYER MOISTURE EXHAUST DUCT MUST BE 4 INCHES IN DIAMETER, AND LENGTH IS LIMITED TO 14 FEET WITH 2 ELBOWS. THE DUCT LENGTH SHALL BE REDUCED BY 2 FT. FOR EVERY ELBOW IN EXCESS OF TWO. (MC.504.3) * DUCTS SHALL BE SIZED PER CHAPTER 6 OF THE MECHANICAL CODE. MECHANICAL NOTES: F ALL FLOORS SHALL BE LAMINATE WOOD PLANKS. B REF. (N) BATHROOM (N)KITCHEN (N)LIVING ROOM (N)BEDROOM WH A 2 F B C W/D NEW WINDOW CEILING ACCESS MIN. 22"X30" 2'-11" 2' - 1 1 " 4'-1 " GFI+44" GFI +72 GFI+44" GF I + 4 4 " GFI+44" GFI+44" 24" 30 " F EXHAUST FAN FOR RANGE HOOD W/ HIGH EFFICACY LIGH (280 CFM) TO BE VENTED TO OUTDOORS. F C C LEFT HANDED OUTSWING 1 ADDS AUTO-OFF CONTROLS FOR LIGHTING IN DRAWERS AND CABINETS. 2. UNDERSHELF, DISPLAY CABINETS, SWITCHED OUTLETS CONTROLLED SEPARATE FROM CEILING LIGHTING. 3. LIGHTING IN HABITABLE SPACES SHALL HAVE ACCESSIBLE WALL-MOUNTED DIMMING CONTROLS. INDOOR LIGHTING CONTROL NOTES (CENC SECTION 150.0): - PROPOSED DUCTLESS HVAC HEAT PUMP SYSTEM. PROPOSED DUCTLESS HVAC DIFFUSER . VS IAQ FAN WITH 32 CFM ( THE IAQ GAN WILL NEED TO BE SEPARATE UNIT WITH MANUAL ON-OFF SWITCH WITH A LABEL NEXT TO THE SWITCH DISPLAYING THE FOLLOWING TEXT. " THIS SWITCH CONTROLS THE INDOOR AIR QUALITY VENTILATION FOR THE HOME. LEAVE THE SWITCH IN THE ON POSITION AT ALL TIMES UNLESS THE OUTDOOR AIR QUALITY IS VERY POOR") (N) BATHROOM 2'-11" 2' - 1 1 " 4'-1 " GF I + 4 4 " 24" 30 " VS PROPOSED UTILITY PLAN SHEET TITLE REVISIONS Sheet A-2.1 This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer designs thereby are and shall remain the property of F. Solis (Draftsman) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F. Solis, visual contact of acceptance of these restrictions. WALL LEGEND AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 FLOOR PLAN KEYNOTES 1 1 1 1 1 2 1 1 PLAN CHECK 10.08.24 1 1 1 1 1 ENLARGED RESTROOM PLAN N.T.S. 1 1 1 1 2 2 2 2 2 2 2 2 PLAN CHECK 11.18.24 2 2 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 - DEMO FLOOR PLAN SHEET TITLE REVISIONS Sheet A-2.2 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis DEMOLITION PLAN KEYNOTES DEMOLITION PLAN LEGEND AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1 PLAN CHECK 10.08.24 2 1 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 - B REF. (N)BATHROOM CEILING HEIGHT 8'-0" (N)KITCHEN CEILING HEIGHT 8'-0" (N)LIVING ROOM CEILING HEIGHT 8'-0" (N)BEDROOM CEILING HEIGHT 8'-0" WH A 2 F B C W/D CEILING ACCESS MIN. 22"X30" 2'-11" 2' - 1 1 " 4'-1 " 24" 30 " (N)KITCHEN ISLAND Aging-in-place/fall prevention notes/features on plans for newly constructed dwelling units: A.Reinforcement for Grab Bars. [R327.1.1] At least one bathroom on the entry level shall be provided with reinforcement installed in accordance with this section. Where there is no bathroom on the entry level, at least one bathroom on the 2nd or 3rd floor of the dwelling shall comply. 1.Reinforcement shall be solid lumber or other construction materials approved by the enforcing agency. 2.Reinforcement shall not be less than 2 by 8 inch nominal lumber (1-1/2” x 7-1/4” actual dimension) or other construction material providing equal height and load capacity. Reinforcement shall be located between 32” and 39-1/4” above the finished floor, flush with the wall framing. 3.Water closet reinforcement shall be installed on both side walls of the fixture, or one side wall and the back wall. 4.Shower reinforcement shall be continuous where wall framing is provided. 5.Bathtub and combination bathtub/shower reinforcement shall be continuous on each end of the bathtub and the back wall. Additionally, back wall reinforcement for a lower grab bar shall be provided with the bottom edge located no more than 6” above the bathtub rim. 6.Where the water closet is not placed adjacent to a side wall capable of accommodating a grab bar, the bathroom shall have provisions for installation of floor-mounted, foldaway or similar alternate grab bar reinforcements approved by the enforcing agency. B.Documentation for Grab Bar Reinforcement. [R327.1.1.1] Information and/or drawings identifying the location of grab bar reinforcement shall be placed in the operation & maintenance manual in accordance with the California Green Building Standards Code, Ch. 4, Division 4.4. C.Electrical Receptacle Outlet, Switch & Control Heights. [R327.1.2] Electrical receptacle outlets, switches and controls (including controls for heating, ventilation and air conditioning) intended to be used by occupants shall be located no more than 48” measured from the top of the outlet box and not less than 15” measured from the bottom of the outlet box above the finish floor. E.Doorbell Buttons. [R327.1.4] Doorbell buttons or controls, when installed, shall not exceed 48” above exterior floor or landing, measured from the top of the doorbell button assembly. Where doorbell buttons integrated with other features are required to be installed above 48” measured from the exterior floor or landing, a standard doorbell button or control shall also be provided at a height not exceeding 48” above exterior floor or landing, measured from the top of the doorbell button or control. 33.Water Heating. Systems using gas or propane water heaters to serve individual dwelling units shall include the following components [150.0(N)]: A.A dedicated 125V, 20A (10 AWG copper branch circuit) electrical receptacle that is within 3 feet from the water heater and accessible to the water heater with no obstructions. There shall be a reserved single pole breaker space in the electrical panel labeled "Future 240V Use". 1.Both ends of the unused conductor shall be labeled with the word “spare” and be electrically isolated. B.A condensate drain that is no more than 2 inches higher than the base of the installed water heater, and allows natural draining without pump assistance. C.Provide a space at least 2.5 ft. by 2.5 ft. wide and 7 ft. tall suitable for the future installation of a heat pump water heater (HPWH). A-4 B A-4 B A-4 A A-4 B PROPOSED FLOOR PLAN SHEET TITLE REVISIONS Sheet A-2.3 This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer designs thereby are and shall remain the property of F. Solis (Draftsman) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F. Solis, visual contact of acceptance of these restrictions. WALL LEGEND AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 FLOOR PLAN KEYNOTES 1 1 1 1 1 1 1 PLAN CHECK 10.08.24 1 1 1 1 1 2 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 2 2 2 1123 S Magnolia Ave Unit# 22/19/2025 ROOF PLAN WITH NEW VENTS ROOF VENT ROOF VENT ESTN SOE NE SOE NE SOE ESTN SOE SCALE: 3/8" = 1'-0" ROOF VENT ROOF VENT ROOF VENT ROOF VENT NE SOE NE SOE This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer ROOF -FRAMING PLAN SHEET TITLE REVISIONS designs thereby are and shall remain the property of F. Solis (Draftsman) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F. Solis, visual contact of acceptance of these restrictions. Sheet A3 ROOF PLAN KEYNOTES AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 ATTIC VENTILATION REQUIREMENTS ATTIC SIZE : 513 SQ. FT. NFA REQUIRED: 513 / 150 = 3.342 SQ. FT. = 483.84 SQ. IN. NFA PROVIDED : (6) DORMER VENTS @ 100 SQ. IN. EA. = 600 SQ. IN. TOTAL NFA 600 SQ. IN. > 483.84 SQ. IN. = O.K. 1 1 PLAN CHECK 10.08.24 2 2 2 2 PLAN CHECK 11.18.24 2 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 1 ATTIC OPEN NEW LIVING ROOM NEW BATHROOM NEW KITCHEN NEW HALLWAY NEW BEDROOM NEW BEDROOM ELEVATIONS SHEET TITLE REVISIONS Sheet A-4 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis EAST ELEVATION SCALE 1 4" = 1'-0" SOUTH ELEVATION SCALE 1 4" = 1'-0" ELEVATION KEYNOTES ELEVATION LEGEND WEST ELEVATION SCALE 1 4" = 1'-0" AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 A - BUILDING SECTION B - BUILDING SECTION. 2 1 PLAN CHECK 10.08.24 1 1 NEW ADDITION 1 2 2 2 2 PLAN CHECK 11.18.24 2 2 2 2 2 2 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 SHEET TITLE REVISIONS Sheet A-5 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 ICC-ESR REPORT 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 SHEET TITLE REVISIONS Sheet A-6 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 ICC-ESR REPORT 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 Sectional View In-O-Vate Technologies Dryerbox 425 In-O-Vate Technologies Dryerbox 425In-O-Vate Technologies Dryerbox 425 In-O-Vate Technologies Dryerbox 425 DETAILS SHEET TITLE REVISIONS Sheet AS-2 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 2 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 DETAILS SHEET TITLE REVISIONS Sheet AS-3 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 3/8" = 1'-0"1 ACCESSIBLE TOILET, LAV. AND ACCESSORIES (ADAAG) N.T.S. CLEARANCE AT WATER CLOSETS4 ACCESSIBLE SHOWER N.T.S TOILET AND SHOWER GRAB BAR BACKING6 N.T.S. CLEARANCE AT WATER CLOSETS23 1-1/2" = 1'-0" TLIE FLOOR5 N.T.S. 1'-0" GRAB BAR REINFORCEMENT SHALL BE MINIMUM 6" HIGH BLOCKING INSTALLED BETWEEN STUDS WITH SIMPSON A34 FRAMING ANCHORS EACH SIDE AND BOTH ENDS. 1123 S Magnolia Ave Unit# 22/19/2025 2X6 CJ @ 16" O.C 2X6 CJ @ 16" O.C L=10'-3"L=4'-9" L= 1 0 ' - 0 " L=7'-4"L=1'-8" L= 2 0 ' - 0 " 6 S-2 7 S-2 8 S-2 4" SLAB W/ #4 @16" EA WAY + 6 MIL / VISQUEEN + 2" SAND T & B 4X 4 N O . 2 4X6 HDR4X4 HDR 4X 4 N O . 2 4X4 NO.2 2 S-2 HDU 2 2 S-2 HDU 2 2 S-2 HDU 2 6X6 POST W/2'X2'X12" PAD 3 - #4 EA WAY HDU 2 2 S-2 EXISTING SLAB FOUNDATION TO REMAIN COAT WITH REDGARD WATERPROFING MEMEBRANE 3 S-2 4 S-2 3 S-2 2 S-2 HDU 2 2 S-2 HDU 2 7 S-2 (E ) 4X 4 H D R 5 S-2 2X6 RR @ 16" O.C 2X6 RR @ 16" O.C 2X8 RIDGE BOARD (CFI) (C F I ) (C F I ) CF-1 = 12" WIDE X 24" DEEP FTG w/ 2 #4 T & B NOTES F-1= 2'-6" SQ X 24" DEEP PAD w/4 #4 EA WAY. F-2= 2'-0" SQ X 24" DEEP PAD w/3 #4 EA WAY. 1 = 5/8" Ø X 12" AB @ 4'-0" w/3" X 3" X 1/4" STL PLATES 4X4 HDR 4X 4 H D R 4X4 HDR4X4 HDR 4X4 HDR 4X4 HDR 3 S-2 7 S-2 HDU 2 2 S-2 2 S-2 HDU 2 9 S-2 9 S-2 REPAIRS (E) S.O.G 1.CLEAN & REMOVE ALL LOOSE DEBRIS. 2.PATCH & FILL ALL CRACKS WITH EPOXY FILLER. 3.COAT WITH REDGARD WATERPROOFING MEMBRANE (ICC-ES-1413) 4.INSTALL ALL PRODUCTS PER MANUFACTURE'S RECOMMENDATIONS. 10 S-2 4 S-2 4" SLAB W/ #4 @16" EA WAY + 6 MIL / VISQUEEN + 2" SAND T & B L= 2 ' - 4 " L= 8 ' - 6 " L= 9 ' - 0 " 10 S-2 6 0F 12 FRAMING / FOUNDATION PLAN SHEET TITLE REVISIONS Sheet S-1 This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer designs thereby are and shall remain the property of F. Solis (Draftsman) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F. Solis, visual contact of acceptance of these restrictions. 1 1 1 PLAN CHECK 04.08.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1123 S Magnolia Ave Unit# 22/19/2025 DETAILS SHEET TITLE REVISIONS Sheet AS-3 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1 PLAN CHECK 10.08.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 3/8" = 1'-0"1 ACCESSIBLE TOILET, LAV. AND ACCESSORIES (ADAAG) N.T.S. CLEARANCE AT WATER CLOSETS4 ACCESSIBLE SHOWER N.T.S TOILET AND SHOWER GRAB BAR BACKING6 N.T.S. CLEARANCE AT WATER CLOSETS23 1-1/2" = 1'-0" TLIE FLOOR5 N.T.S. 1'-0" GRAB BAR REINFORCEMENT SHALL BE MINIMUM 6" HIGH BLOCKING INSTALLED BETWEEN STUDS WITH SIMPSON A34 FRAMING ANCHORS EACH SIDE AND BOTH ENDS. 1123 S Magnolia Ave Unit# 22/19/2025 ^ǊɟÝŗµÝŗ^rɭ µrŗrǊĵŗŷǻrǢʲ ǢǻǊȕNǻȕǊĵǻrǢǻǢŗ^ÝŗǢƻrNǻÝŷŗ DȕÝĵ^ÝŗµNŷ^rĵŷ^ÝŗµNǊÝǻrǊÝŗŷǻrǢɟŷŷ^®ǊōÝŗµŗŷǻrǢ ǊrÝŗ®ŷǊNr^NŷŗNǊrǻrŗŷǻrǢ ƻŷǢǻ˚ÝŗǢǻĵĵr^NŷŗNǊrǻrˀōǢŷŗǊɳŗNËŷǊŗŷǻrǢ ®ŷȕŗ^ǻÝŷŗŗŷǻrǢ GE N E R A L N O T E S S1.0 CON S U L T I N G S T R U C T U R A L E N G I N E E R S 1123 S Magnolia Ave Unit# 22/19/2025 RAFT E R RAFT E R 7 2" RIDGE R-15 INSULATION AT NEW ROOF SHINGLE RIDGE CAP SHINGLE FELT PAPER ROOF SHEATING COR A VENT V-600 11" CONTINUOUS RIDGE VENT OR SIMILAR EXHAUST Sectional View In-O-Vate Technologies Dryerbox 425 In-O-Vate Technologies Dryerbox 425In-O-Vate Technologies Dryerbox 425 In-O-Vate Technologies Dryerbox 425 DETAILS SHEET TITLE REVISIONS Sheet AS-2 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 1 1 PLAN CHECK 10.08.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 1123 S Magnolia Ave Unit# 22/19/2025 REF. (N) BATHROOM (N) KITCHEN (N) LIVING ROOM (N) BEDROOM WH F W/D CEILING ACCESS MIN. 22"X30" 2'-11" 2' - 1 1 " 4'-1 " 24" 30 " F C C SHALL HAVE ACCESSIBLE WALL-MOUNTED DIMMING CONTROLS. - 1 GROUND FLOOR & FOUNDATION PLAN SCALE: 1/4"=1'-0"S2.0 N NOTE: (E) CONDITIONS ARE SHOWN TO THE BEST OF OUR KNOWLEDGE AND BASED ON REASONABLE ASSUMPTIONS. THE CONTRACTOR SHOULD VERIFY ALL (E) FIELD CONDITIONS BEFORE COMMENCING WORK. THE CONTRACTOR SHALL NOTIFY THE STRUCTURAL ENGINEER IF CONDITIONS ARE DIFFERENT THAN THAT SHOWN. 4 EXT. WALL FND. W/ CURB SCALE: 3/4"=1'-0"240906 S2.0|12 2 INT. CONC. SLAB ON GRADE SCALE: 3/4"=1'-0"240906 S2.0|123EXT. CONC. SLAB ON GRADE SCALE: 3/4"=1'-0"240906 S2.0|125EXT. WALL FND. W/ CURB SCALE: 3/4"=1'-0"240906 S2.0|12 6 (E)WALL FND. W/ CURB SCALE: 3/4"=1'-0"240906 S2.0|12 7 (E)WALL FND. W/(N) CURB SCALE: 3/4"=1'-0"240906 S2.0|12 8 EXT. WALL FND. W/ CURB SCALE: 3/4"=1'-0"240906 S2.0|12 9 (N)FND. TO (E)FND. SCALE: 3/4"=1'-0"240906 S2.0|12 10 CONC. S.O.G. EDGE SCALE: 3/4"=1'-0"240906 S2.0|12 11 POST FOUNDATION SCALE: 3/4"=1'-0"240906 S2.0|12 GR O U N D F L O O R & FO U N D A T I O N P L A N & DE T A I L S S2.0 CON S U L T I N G S T R U C T U R A L E N G I N E E R S 1123 S Magnolia Ave Unit# 22/19/2025 ROOF VENT ROOF VENT EXISTING SLOPE NEW SLOPE NEW SLOPE EXISTING SLOPE ROOF VENT ROOF VENT ROOF VENT ROOF VENT NEW SLOPE NEW SLOPE 1 ROOF FRAMING PLAN SCALE: 1/4"=1'-0"S2.1 N 4 ROOF FRAMING SCALE: 3/4"=1'-0"241220 S2.1|12 3 RIDGE BEAM CONNECTION SCALE: 3/4"=1'-0"241220 S2.1|12 2 ROOF FRAMING SCALE: 3/4"=1'-0"241220 S2.1|12 5 (N)ROOF TO (E)ROOF FRMG. SCALE: 3/4"=1'-0"241220 S2.1|12 6 (N)ROOF TO (E)ROOF FRMG. SCALE: 3/4"=1'-0"241220 S2.1|12 7 (N)ROOF TO (E)ROOF FRMG. SCALE: 3/4"=1'-0"241220 S2.1|12 8 ROOF BEAM CONNECT. SCALE: 3/4"=1'-0"241220 S2.1|12 9 (N)CEILING JOIST FRAMING SCALE: 3/4"=1'-0"241220 S2.1|12 10 ROOF FRAMING SCALE: 3/4"=1'-0"241220 S2.1|12 11 ROOF FRAMING SCALE: 3/4"=1'-0"241220 S2.1|12 RO O F F R A M I N G P L A N & D E T A I L S S2.1 CON S U L T I N G S T R U C T U R A L E N G I N E E R S 1123 S Magnolia Ave Unit# 22/19/2025 6 INTERSECTING HOLDOWNS SCALE: 3/4"=1'-0" 3 NOT USED SCALE: 3/4"=1'-0" 9 HOLDOWN TO (E)FND. SCALE: 3/4"=1'-0" 8 HOLDOWN W/ CURB SCALE: 3/4"=1'-0" 1B (N)PERFORATED WOOD SHEARWALL ELEV. TO (E)WALL FRMG. SCALE: 1/2"=1'-0" 1A PERFORATED WOOD SHEARWALL ELEVATION SCALE: 1/2"=1'-0" 2 MIN. PANEL EDGE NAILING SCALE: 3"=1'-0" 4 TYP. BOLTED HOLDOWN SCALE: 1 1/2"=1'-0" 5 NOT USED SCALE: 1 1/2"=1'-0" 7 NOT USED SCALE: 1 1/2"=1'-0" SH E A R W A L L & FR A M I N G D E T A I L S S3.0 CON S U L T I N G S T R U C T U R A L E N G I N E E R S 1123 S Magnolia Ave Unit# 22/19/2025 SHEET TITLE REVISIONS Sheet A-7 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 CAL-GREEN CHAPTER 4 RESIDENTIAL MANDATORY MEASURES DIVISION 4.1 PLANNING AND DESIGN DIVISION 4.3 WATER EFFICIENCY AND CONSERVATION 4.406 ENHANCED DURABILITY AND REDUCED MAINTENANCE 4.406.1 RODENT PROOFING. Annular spaces around pipes, electric cables, conduits or other openings in sole/bottom plates at exterior walls shall be protected against the passage of rodents by closing such openings with cement mortar, concrete masonry or a similar method acceptable to the enforcing agency. 4.408 CONSTRUCTION WASTE REDUCTION, DISPOSAL AND RECYCLING 4.408.1 CONSTRUCTION WASTE MANAGEMENT. Recycle and/or salvage for reuse a minimum of 65 percent of the non-hazardous construction and demolition waste in accordance with either Section 4.408.2, 4.408.3 or 4.408.4, or meet a more stringent local construction and demolition waste management ordinance. Exceptions: 1. Excavated soil and land-clearing debris. 2. Alternate waste reduction methods developed by working with local agencies if diversion or recycle facilities capable of compliance with this item do not exist or are not located reasonably close to the jobsite. 3. The enforcing agency may make exceptions to the requirements of this section when isolated jobsites are located in areas beyond the haul boundaries of the diversion facility. 4.408.2 CONSTRUCTION WASTE MANAGEMENT PLAN. Submit a construction waste management plan in conformance with Items 1 through 5. The construction waste management plan shall be updated as necessary and shall be available during construction for examination by the enforcing agency. 1. Identify the construction and demolition waste materials to be diverted from disposal by recycling, reuse on the project or salvage for future use or sale. 2. Specify if construction and demolition waste materials will be sorted on-site (source separated) or bulk mixed (single stream). 3. Identify diversion facilities where the construction and demolition waste material collected will be taken. 4. Identify construction methods employed to reduce the amount of construction and demolition waste generated. 5. Specify that the amount of construction and demolition waste materials diverted shall be calculated by weight or volume, but not by both. 4.408.3 WASTE MANAGEMENT COMPANY. Utilize a waste management company, approved by the enforcing agency, which can provide verifiable documentation that the percentage of construction and demolition waste material diverted from the landfill complies with Section 4.408.1. Note: The owner or contractor may make the determination if the construction and demolition waste materials will be diverted by a waste management company. 4.408.4 WASTE STREAM REDUCTION ALTERNATIVE [LR]. Projects that generate a total combined weight of construction and demolition waste disposed of in landfills, which do not exceed 3.4 lbs./sq.ft. of the building area shall meet the minimum 65% construction waste reduction requirement in Section 4.408.1 4.408.4.1 WASTE STREAM REDUCTION ALTERNATIVE. Projects that generate a total combined weight of construction and demolition waste disposed of in landfills, which do not exceed 2 pounds per square foot of the building area, shall meet the minimum 65% construction waste reduction requirement in Section 4.408.1 4.408.5 DOCUMENTATION. Documentation shall be provided to the enforcing agency which demonstrates compliance with Section 4.408.2, items 1 through 5, Section 4.408.3 or Section 4.408.4.. Notes: 1. Sample forms found in "A Guide to the California Green Building Standards Code (Residential)" located at www.hcd.ca.gov/CALGreen.html may be used to assist in documenting compliance with this section. 2. Mixed construction and demolition debris (C & D) processors can be located at the California Department of Resources Recycling and Recovery (CalRecycle). 4.410 BUILDING MAINTENANCE AND OPERATION 4.410.1 OPERATION AND MAINTENANCE MANUAL. At the time of final inspection, a manual, compact disc, web-based reference or other media acceptable to the enforcing agency which includes all of the following shall be placed in the building: 1. Directions to the owner or occupant that the manual shall remain with the building throughout the life cycle of the structure. 2. Operation and maintenance instructions for the following: a. Equipment and appliances, including water-saving devices and systems, HVAC systems, photovoltaic systems, electric vehicle chargers, water-heating systems and other major appliances and equipment. b. Roof and yard drainage, including gutters and downspouts. c. Space conditioning systems, including condensers and air filters. d. Landscape irrigation systems. e. Water reuse systems. 3. Information from local utility, water and waste recovery providers on methods to further reduce resource consumption, including recycle programs and locations. 4. Public transportation and/or carpool options available in the area. 5. Educational material on the positive impacts of an interior relative humidity between 30-60 percent and what methods an occupant may use to maintain the relative humidity level in that range. 6. Information about water-conserving landscape and irrigation design and controllers which conserve water. 7. Instructions for maintaining gutters and downspouts and the importance of diverting water at least 5 feet away from the foundation. 8. Information on required routine maintenance measures, including, but not limited to, caulking, painting, grading around the building, etc. 9. Information about state solar energy and incentive programs available. 10. A copy of all special inspections verifications required by the enforcing agency or this code. 11. Information from the Department of Forestry and Fire Protection on maintenance of defensible space around residential structures. 12. Information and/or drawings identifying the location of grab bar reinforcements. 4.410.2 RECYCLING BY OCCUPANTS. Where 5 or more multifamily dwelling units are constructed on a building site, provide readily accessible area(s) that serves all buildings on the site and are identified for the depositing, storage and collection of non-hazardous materials for recycling, including (at a minimum) paper, corrugated cardboard, glass, plastics, organic waster, and metals, or meet a lawfully enacted local recycling ordinance, if more restrictive. Exception: Rural jurisdictions that meet and apply for the exemption in Public Resources Code Section 42649.82 (a)(2)(A) et seq. are note required to comply with the organic waste portion of this section. DIVISION 4.4 MATERIAL CONSERVATION AND RESOURCE EFFICIENCY DIVISION 4.5 ENVIRONMENTAL QUALITY 4.303 INDOOR WATER USE 4.303.1 WATER CONSERVING PLUMBING FIXTURES AND FITTINGS. Plumbing fixtures (water closets and urinals) and fittings (faucets and showerheads) shall comply with the sections 4.303.1.1, 4.303.1.2, 4.303.1.3, and 4.303.4.4. Note: All noncompliant plumbing fixtures in any residential real property shall be replaced with water-conserving plumbing fixtures. Plumbing fixture replacement is required prior to issuance of a certificate of final completion, certificate of occupancy, or final permit approval by the local building department. See Civil Code Section 1101.1, et seq., for the definition of a noncompliant plumbing fixture, types of residential buildings affected and other important enactment dates. 4.303.1.1 Water Closets. The effective flush volume of all water closets shall not exceed 1.28 gallons per flush. Tank-type water closets shall be certified to the performance criteria of the U.S. EPA WaterSense Specification for Tank-type Toilets. Note: The effective flush volume of dual flush toilets is defined as the composite, average flush volume of two reduced flushes and one full flush. 4.303.1.2 Urinals. The effective flush volume of wall mounted urinals shall not exceed 0.125 gallons per flush. The effective flush volume of all other urinals shall not exceed 0.5 gallons per flush. 4.303.1.3 Showerheads. 4.303.1.3.1 Single Showerhead. Showerheads shall have a maximum flow rate of not more than 1.8 gallons per minute at 80 psi. Showerheads shall be certified to the performance criteria of the U.S. EPA WaterSense Specification for Showerheads. 4.303.1.3.2 Multiple showerheads serving one shower. When a shower is served by more than one showerhead, the combined flow rate of all the showerheads and/or other shower outlets controlled by a single valve shall not exceed 1.8 gallons per minute at 80 psi, or the shower shall be designed to only allow one shower outlet to be in operation at a time. Note: A hand-held shower shall be considered a showerhead. 4.303.1.4 Faucets. 4.303.1.4.1 Residential Lavatory Faucets. The maximum flow rate of residential lavatory faucets shall not exceed 1.2 gallons per minute at 60 psi. The minimum flow rate of residential lavatory faucets shall not be less than 0.8 gallons per minute at 20 psi. 4.303.1.4.2 Lavatory Faucets in Common and Public Use Areas. The maximum flow rate of lavatory faucets installed in common and public use areas (outside of dwellings or sleeping units) in residential buildings shall not exceed 0.5 gallons per minute at 60 psi. 4.303.1.4.3 Metering Faucets. Metering faucets when installed in residential buildings shall not deliver more than 0.2 gallons per cycle. 4.303.1.4.4 Kitchen Faucets. The maximum flow rate of kitchen faucets shall not exceed 1.8 gallons per minute at 60 psi. Kitchen faucets may temporarily increase the flow above the maximum rate, but not to exceed 2.2 gallons per minute at 60 psi, and must default to a maximum flow rate of 1.8 gallons per minute at 60 psi. Note: Where complying faucets are unavailable, aerators or other means may be used to achieve reduction. 4.303.1.4.5 Pre-rinse spray valves. When installed, shall meet the requirements in the California Code of Regulations, Title 20 (Appliance Efficiency Regulations), Sections 1605.1 (h)(4) Table H-2, Section 1605.3 (h)(4)(A), and Section 1607 (d)(7) and shall be equipped with an integral automatic shutoff. FOR REFERENCE ONLY: The following table and code section have been reprinted from the California Code of Regulations, Title 20 (Appliance Efficiency Regulations),Section 1605.1 (h)(4) and Section 1605.3 (h)(4)(A). Title 20 Section 1605.3 (h)(4)(A): Commercial prerinse spray values manufactured on or after January 1, 2006, shall have a minimum spray force of not less than 4.0 ounces-force (ozf)[113 grams-force(gf)] 4.303.2 Submeters for multifamily buildings and dwelling units in mixed-used residential/commercial buildings. Submeters shall be installed to measure water usage of individual rental dwelling units in accordance with the California Plumbing Code. 4.303.3 Standards for plumbing fixtures and fittings. Plumbing fixtures and fittings shall be installed in accordance with the California Plumbing Code, and shall meet the applicable standards referenced in Table 1701.1 of the California Plumbing Code. TABLE - MAXIMUM FIXTURE WATER USE FIXTURE TYPE FLOW RATE SHOWER HEADS (RESIDENTIAL)1.8 GMP @ 80 PSI LAVATORY FAUCETS (RESIDENTIAL)MAX. 1.2 GPM @ 60 PSI MIN. 0.8 GPM @ 20 PSI LAVATORY FAUCETS IN COMMON & PUBLIC USE AREAS 0.5 GPM @ 60 PSI KITCHEN FAUCETS 1.8 GPM @ 60 PSI METERING FAUCETS 0.2 GAL/CYCLE WATER CLOSET 1.28 GAL/FLUSH URINALS 0.125 GAL/FLUSH 4.304 OUTDOOR WATER USE 4.304.1 OUTDOOR POTABLE WATER USE IN LANDSCAPE AREAS. Residential developments shall comply with a local water efficient landscape ordinance or the current California Department of Water Resources' Model Water Efficient Landscape Ordinance (MWELO), whichever is more stringent. NOTES: 1. The Model Water Efficient Landscape Ordinance (MWELO) is located in the California Code Regulations, Title 23, Chapter 2.7, Division 2. MWELO and supporting documents, including water budget calculator, are available at: https://www.water.ca.gov/ ABBREVIATION DEFINITIONS: HCD Department of Housing and Community Development BSC California Building Standards Commission DSA-SS Division of the State Architect, Structural Safety OSHPD Office of Statewide Health Planning and Development LR Low Rise HR High Rise AA Additions and Alterations N New NOTE: THIS TABLE COMPILES THE DATA IN SECTION 4.303.1, AND IS INCLUDED AS A CONVENIENCE FOR THE USER. SECTION 4.102 DEFINITIONS 4.102.1 DEFINITIONS The following terms are defined in Chapter 2 (and are included here for reference) FRENCH DRAIN. A trench, hole or other depressed area loosely filled with rock, gravel, fragments of brick or similar pervious material used to collect or channel drainage or runoff water. WATTLES. Wattles are used to reduce sediment in runoff. Wattles are often constructed of natural plant materials such as hay, straw or similar material shaped in the form of tubes and placed on a downflow slope. Wattles are also used for perimeter and inlet controls. 4.106 SITE DEVELOPMENT 4.106.1 GENERAL. Preservation and use of available natural resources shall be accomplished through evaluation and careful planning to minimize negative effects on the site and adjacent areas. Preservation of slopes, management of storm water drainage and erosion controls shall comply with this section. 4.106.2 STORM WATER DRAINAGE AND RETENTION DURING CONSTRUCTION. Projects which disturb less than one acre of soil and are not part of a larger common plan of development which in total disturbs one acre or more, shall manage storm water drainage during construction. In order to manage storm water drainage during construction, one or more of the following measures shall be implemented to prevent flooding of adjacent property, prevent erosion and retain soil runoff on the site. 1. Retention basins of sufficient size shall be utilized to retain storm water on the site. 2. Where storm water is conveyed to a public drainage system, collection point, gutter or similar disposal method, water shall be filtered by use of a barrier system, wattle or other method approved by the enforcing agency. 3. Compliance with a lawfully enacted storm water management ordinance. Note: Refer to the State Water Resources Control Board for projects which disturb one acre or more of soil, or are part of a larger common plan of development which in total disturbs one acre or more of soil. (Website: https://www.waterboards.ca.gov/water_issues/programs/stormwater/construction.html) 4.106.3 GRADING AND PAVING. Construction plans shall indicate how the site grading or drainage system will manage all surface water flows to keep water from entering buildings. Examples of methods to manage surface water include, but are not limited to, the following: 1. Swales 2. Water collection and disposal systems 3. French drains 4. Water retention gardens 5. Other water measures which keep surface water away from buildings and aid in groundwater recharge. Exception: Additions and alterations not altering the drainage path. 4.106.4 Electric vehicle (EV) charging for new construction. New construction shall comply with Sections 4.106.4.1 or 4.106.4.2 to facilitate future installation and use of EV chargers. Electric vehicle supply equipment (EVSE) shall be installed in accordance with the California Electrical Code, Article 625. Exceptions: 1. On a case-by-case basis, where the local enforcing agency has determined EV charging and infrastructure are not feasible based upon one or more of the following conditions: 1.1 Where there is no local utility power supply or the local utility is unable to supply adequate power. 1.2 Where there is evidence suitable to the local enforcing agency substantiating that additional local utility infrastructure design requirements, directly related to the implementation of Section 4.106.4, may adversely impact the construction cost of the project. 2. Accessory Dwelling Units (ADU) and Junior Accessory Dwelling Units (JADU) without additional parking facilities. 4.106.4.1 New one- and two-family dwellings and townhouses with attached private garages. For each dwelling unit, install a listed raceway to accommodate a dedicated 208/240-volt branch circuit. The raceway shall not be less than trade size 1 (nominal 1-inch inside diameter). The raceway shall originate at the main service or subpanel and shall terminate into a listed cabinet, box or other enclosure in close proximity to the proposed location of an EV charger. Raceways are required to be continuous at enclosed, inaccessible or concealed areas and spaces. The service panel and/or subpanel shall provide capacity to install a 40-ampere 208/240-volt minimum dedicated branch circuit and space(s) reserved to permit installation of a branch circuit overcurrent protective device. Exemption: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the proposed location of an EV charger at the time of original construction in accordance with the California Electrical Code. 4.106.4.1.1 Identification. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging as "EV CAPABLE". The raceway termination location shall be permanently and visibly marked as "EV CAPABLE". CHAPTER 3 GREEN BUILDING SECTION 301 GENERAL 301.1 SCOPE. Buildings shall be designed to include the green building measures specified as mandatory in the application checklists contained in this code. Voluntary green building measures are also included in the application checklists and may be included in the design and construction of structures covered by this code, but are not required unless adopted by a city, county, or city and county as specified in Section 101.7. 301.1.1 Additions and alterations. [HCD] The mandatory provisions of Chapter 4 shall be applied to additions or alterations of existing residential buildings where the addition or alteration increases the building's conditioned area, volume, or size. The requirements shall apply only to and/or within the specific area of the addition or alteration. The mandatory provision of Section 4.106.4.2 may apply to additions or alterations of existing parking facilities or the addition of new parking facilities serving existing multifamily buildings. See Section 4.106.4.3 for application. Note: Repairs including, but not limited to, resurfacing, restriping and repairing or maintaining existing lighting fixtures are not considered alterations for the purpose of this section. Note: On and after January 1, 2014, residential buildings undergoing permitted alterations, additions, or improvements shall replace noncompliant plumbing fixtures with water-conserving plumbing fixtures. Plumbing fixture replacement is required prior to issuance of a certificate of final completion, certificate of occupancy or final permit approval by the local building department. See Civil Code Section 1101.1, et seq., for the definition of a noncompliant plumbing fixture, types of residential buildings affected and other important enactment dates. 301.2 LOW-RISE AND HIGH-RISE RESIDENTIAL BUILDINGS. [HCD] The provisions of individual sections of CALGreen may apply to either low-rise residential buildings high-rise residential buildings, or both. Individual sections will be designated by banners to indicate where the section applies specifically to low-rise only (LR) or high-rise only (HR). When the section applies to both low-rise and high-rise buildings, no banner will be used. SECTION 302 MIXED OCCUPANCY BUILDINGS 302.1 MIXED OCCUPANCY BUILDINGS. In mixed occupancy buildings, each portion of a building shall comply with the specific green building measures applicable to each specific occupancy. Exceptions: 1. [HCD] Accessory structures and accessory occupancies serving residential buildings shall comply with Chapter 4 and Appendix A4, as applicable. 2. [HCD] For purposes of CALGreen, live/work units, complying with Section 419 of the California Building Code, shall not be considered mixed occupancies. Live/Work units shall comply with Chapter 4 and Appendix A4, as applicable. 4.106.4.2 New multifamily dwellings, hotels and motels and new residential parking facilities. When parking is provided, parking spaces for new multifamily dwellings, hotels and motels shall meet the requirements of Sections 4.106.4.2.1 and 4.106.4.2.2. Calculations for spaces shall be rounded up to the nearest whole number. A parking space served by electric vehicle supply equipment or designed as a future EV charging space shall count as at least one standard automobile parking space only for the purpose of complying with any applicable minimum parking space requirements established by a local jurisdiction. See Vehicle Code Section 22511.2 for further details. 4.106.4.2.1Multifamily development projects with less than 20 dwelling units; and hotels and motels with less than 20 sleeping units or guest rooms. The number of dwelling units, sleeping units or guest rooms shall be based on all buildings on a project site subject to this section. 1.EV Capable. Ten (10) percent of the total number of parking spaces on a building site, provided for all types of parking facilities, shall be electric vehicle charging spaces (EV spaces) capable of supporting future Level 2 EVSE. Electrical load calculations shall demonstrate that the electrical panel service capacity and electrical system, including any on-site distribution transformer(s), have sufficient capacity to simultaneously charge all EVs at all required EV spaces at a minimum of 40 amperes. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging purposes as “EV CAPABLE” in accordance with the California Electrical Code. Exceptions: 1.When EV chargers (Level 2 EVSE) are installed in a number equal to or greater than the required number of EV capable spaces. 2.When EV chargers (Level 2 EVSE) are installed in a number less than the required number of EV capable spaces, the number of EV capable spaces required may be reduced by a number equal to the number of EV chargers installed. Notes: a.Construction documents are intended to demonstrate the project’s capability and capacity for facilitating future EV charging. b.There is no requirement for EV spaces to be constructed or available until receptacles for EV charging or EV chargers are installed for use. 2.EV Ready. Twenty-five (25) percent of the total number of parking spaces shall be equipped with low power Level 2 EV charging receptacles. For multifamily parking facilities, no more than one receptacle is required per dwelling unit when more than one parking space is provided for use by a single dwelling unit. Exception: Areas of parking facilities served by parking lifts. 4.106.4.2.2 Multifamily development projects with 20 or more dwelling units, hotels and motels with 20 or more sleeping units or guest rooms. The number of dwelling units, sleeping units or guest rooms shall be based on all buildings on a project site subject to this section. 1.EV Capable. Ten (10) percent of the total number of parking spaces on a building site, provided for all types of parking facilities, shall be electric vehicle charging spaces (EV spaces) capable of supporting future Level 2 EVSE. Electrical load calculations shall demonstrate that the electrical panel service capacity and electrical system, including any on-site distribution transformer(s), have sufficient capacity to simultaneously charge all EVs at all required EV spaces at a minimum of 40 amperes. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging purposes as “EV CAPABLE” in accordance with the California Electrical Code. Exception: When EV chargers (Level 2 EVSE) are installed in a number greater than five (5) percent of parking spaces required by Section 4.106.4.2.2, Item 3, the number of EV capable spaces required may be reduced by a number equal to the number of EV chargers installed over the five (5) percent required. Notes: a.Construction documents shall show locations of future EV spaces. b.There is no requirement for EV spaces to be constructed or available until receptacles for EV charging or EV chargers are installed for use. 2.EV Ready. Twenty-five (25) percent of the total number of parking spaces shall be equipped with low power Level 2 EV charging receptacles. For multifamily parking facilities, no more than one receptacle is required per dwelling unit when more than one parking space is provided for use by a single dwelling unit. Exception: Areas of parking facilities served by parking lifts. 3.EV Chargers. Five (5) percent of the total number of parking spaces shall be equipped with Level 2 EVSE. Where common use parking is provided, at least one EV charger shall be located in the common use parking area and shall be available for use by all residents or guests. When low power Level 2 EV charging receptacles or Level 2 EVSE are installed beyond the minimum required, an automatic load management system (ALMS) may be used to reduce the maximum required electrical capacity to each space served by the ALMS. The electrical system and any on-site distribution transformers shall have sufficient capacity to deliver at least 3.3 kW simultaneously to each EV charging station (EVCS) served by the ALMS. The branch circuit shall have a minimum capacity of 40 amperes, and installed EVSE shall have a capacity of not less than 30 amperes. ALMS shall not be used to reduce the minimum required electrical capacity to the required EV capable spaces. 4.106.4.2.2.1 Electric vehicle charging stations (EVCS). Electric vehicle charging stations required by Section 4.106.4.2.2, Item 3, shall comply with Section 4.106.4.2.2.1. Exception: Electric vehicle charging stations serving public accommodations, public housing, motels and hotels shall not be required to comply with this section. See California Building Code, Chapter 11B, for applicable requirements. 4.106.4.2.2.1.1 Location. EVCS shall comply with at least one of the following options: 1.The charging space shall be located adjacent to an accessible parking space meeting the requirements of the California Building Code, Chapter 11A, to allow use of the EV charger from the accessible parking space. 2.The charging space shall be located on an accessible route, as defined in the California Building Code, Chapter 2, to the building. Exception: Electric vehicle charging stations designed and constructed in compliance with the California Building Code, Chapter 11B, are not required to comply with Section 4.106.4.2.2.1.1 and Section 4.106.4.2.2.1.2, Item 3. 4.106.4.2.2.1.2 Electric vehicle charging stations (EVCS) dimensions. The charging spaces shall be designed to comply with the following: 1.The minimum length of each EV space shall be 18 feet (5486 mm). 2.The minimum width of each EV space shall be 9 feet (2743 mm). 3.One in every 25 charging spaces, but not less than one, shall also have an 8-foot (2438 mm) wide minimum aisle. A 5-foot (1524 mm) wide minimum aisle shall be permitted provided the minimum width of the EV space is 12 feet (3658 mm). a.Surface slope for this EV space and the aisle shall not exceed 1 unit vertical in 48 units horizontal (2.083 percent slope) in any direction. 4.106.4.2.2.1.3 Accessible EV spaces. In addition to the requirements in Sections 4.106.4.2.2.1.1 and 4.106.4.2.2.1.2, all EVSE, when installed, shall comply with the accessibility provisions for EV chargers in the California Building Code, Chapter 11B. EV ready spaces and EVCS in multifamily developments shall comply with California Building Code, Chapter 11A, Section 1109A. 4.106.4.2.3 EV space requirements. 1.Single EV space required. Install a listed raceway capable of accommodating a 208/240-volt dedicated branch circuit. The raceway shall not be less than trade size 1 (nominal 1-inch inside diameter). The raceway shall originate at the main service or subpanel and shall terminate into a listed cabinet, box or enclosure in close proximity to the location or the proposed location of the EV space. Construction documents shall identify the raceway termination point, receptacle or charger location, as applicable. The service panel and/ or subpanel shall have a 40-ampere minimum dedicated branch circuit, including branch circuit overcurrent protective device installed, or space(s) reserved to permit installation of a branch circuit overcurrent protective device. Exception: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the location or the proposed location of the EV space, at the time of original construction in accordance with the California Electrical Code. 2.Multiple EV spaces required. Construction documents shall indicate the raceway termination point and the location of installed or future EV spaces, receptacles or EV chargers. Construction documents shall also provide information on amperage of installed or future receptacles or EVSE, raceway method(s), wiring schematics and electrical load calculations. Plan design shall be based upon a 40-ampere minimum branch circuit. Required raceways and related components that are planned to be installed underground, enclosed, inaccessible or in concealed areas and spaces shall be installed at the time of original construction. SECTION 4.501 GENERAL 4.501.1 Scope The provisions of this chapter shall outline means of reducing the quality of air contaminants that are odorous, irritating and/or harmful to the comfort and well being of a building's installers, occupants and neighbors. SECTION 4.502 DEFINITIONS 5.102.1 DEFINITIONS The following terms are defined in Chapter 2 (and are included here for reference) AGRIFIBER PRODUCTS. Agrifiber products include wheatboard, strawboard, panel substrates and door cores, not including furniture, fixtures and equipment (FF&E) not considered base building elements. COMPOSITE WOOD PRODUCTS. Composite wood products include hardwood plywood, particleboard and medium density fiberboard. "Composite wood products" does not include hardboard, structural plywood, structural panels, structural composite lumber, oriented strand board, glued laminated timber, prefabricated wood I-joists or finger-jointed lumber, all as specified in California Code of regulations (CCR), title 17, Section 93120.1. DIRECT-VENT APPLIANCE. A fuel-burning appliance with a sealed combustion system that draws all air for combustion from the outside atmosphere and discharges all flue gases to the outside atmosphere. DISCLAIMER:THIS DOCUMENT IS PROVIDED AND INTENDED TO BE USED AS A MEANS TO INDICATE AREAS OF COMPLIANCE WITH THE CALIFORNIA GREEN BUILDING STANDARDS (CALGREEN) CODE. DUE TO THE VARIABLES BETWEEN BUILDING DEPARTMENT JURISDICTIONS, THIS CHECKLIST IS TO BE USED ON AN INDIVIDUAL PROJECT BASIS AND MAY BE MODIFIED BY THE END USER TO MEET THOSE INDIVIDUAL NEEDS. THE END USER ASSUMES ALL RESPONSIBILITY ASSOCIATED WITH THE USE OF THIS DOCUMENT, INCLUDING VERIFICATION WITH THE FULL CODE. Y N/AYN/AYN/AYN/A RESPON. PARTY RESPON. PARTY RESPON. PARTY RESPON. PARTY 2022 CALIFORNIA GREEN BUILDING STANDARDS CODE RESIDENTIAL MANDATORY MEASURES, SHEET 1 (January 2023)Y = YES N/A =NOT APPLICABLE RESPON. PARTY =RESPONSIBLE PARTY (ie: ARCHITECT, ENGINEER, OWNER, CONTRACTOR, INSPECTOR ETC.) 4.201 GENERAL 4.201.1 SCOPE. For the purposes of mandatory energy efficiency standards in this code, the California Energy Commission will continue to adopt mandatory standards. DIVISION 4.2 ENERGY EFFICIENCY TABLE H-2 STANDARDS FOR COMMERCIAL PRE-RINSE SPRAY VALUES MANUFACTURED ON OR AFTER JANUARY 28, 2019 PRODUCT CLASS [spray force in ounce force (ozf)]MAXIMUM FLOW RATE (gpm) Product Class 1 (≤1.00 Product Class 2 (> 5.0 ozf and ≤1.20 Product Class 3 (> 8.0 ozf)1.28 Exception: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the location or the proposed location of the EV space at the time of original construction in accordance with the California Electrical Code. 4.106.4.2.4 Identification. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging purposes as “EV CAPABLE” in accordance with the California Electrical Code. 4.106.4.2.5 Electric Vehicle Ready Space Signage. Electric vehicle ready spaces shall be identified by signage or pavement markings, in compliance with Caltrans Traffic Operations Policy Directive 13-01 (Zero Emission Vehicle Signs and Pavement Markings) or its successor(s). 4.106.4.3 Electric vehicle charging for additions and alterations of parking facilities serving existing multifamily buildings. When new parking facilities are added, or electrical systems or lighting of existing parking facilities are added or altered and the work requires a building permit, ten (10) percent of the total number of parking spaces added or altered shall be electric vehicle charging spaces (EV spaces) capable of supporting future Level 2 EVSE. Notes: 1.Construction documents are intended to demonstrate the project’s capability and capacity for facilitating future EV charging. 2.There is no requirement for EV spaces to be constructed or available until EV chargers are installed for use. 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 SHEET TITLE REVISIONS Sheet A-8 hisraisseciicatisaieas iththeseraisshallcstitteeiece Disclaimer esisthereareashallremaithe rertSlisDratsmaaart thereshallecieisclset thersrseicectiitha rrrectrhichtherehaeee reareaeeleithtthe therittecsetSlisisalctact accetacetheserestrictis AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 CAL-GREEN MAXIMUM INCREMENTAL REACTIVITY (MIR). The maximum change in weight of ozone formed by adding a compound to the "Base Reactive Organic Gas (ROG) Mixture" per weight of compound added, expressed to hundredths of a gram (g O³/g ROC). Note: MIR values for individual compounds and hydrocarbon solvents are specified in CCR, Title 17, Sections 94700 and 94701. MOISTURE CONTENT. The weight of the water in wood expressed in percentage of the weight of the oven-dry wood. PRODUCT-WEIGHTED MIR (PWMIR). The sum of all weighted-MIR for all ingredients in a product subject to this article. The PWMIR is the total product reactivity expressed to hundredths of a gram of ozone formed per gram of product (excluding container and packaging). Note: PWMIR is calculated according to equations found in CCR, Title 17, Section 94521 (a). REACTIVE ORGANIC COMPOUND (ROC). Any compound that has the potential, once emitted, to contribute to ozone formation in the troposphere. VOC. A volatile organic compound (VOC) broadly defined as a chemical compound based on carbon chains or rings with vapor pressures greater than 0.1 millimeters of mercury at room temperature. These compounds typically contain hydrogen and may contain oxygen, nitrogen and other elements. See CCR Title 17, Section 94508(a). 4.503 FIREPLACES 4.503.1 GENERAL. Any installed gas fireplace shall be a direct-vent sealed-combustion type. Any installed woodstove or pellet stove shall comply with U.S. EPA New Source Performance Standards (NSPS) emission limits as applicable, and shall have a permanent label indicating they are certified to meet the emission limits. Woodstoves, pellet stoves and fireplaces shall also comply with applicable local ordinances. 4.504 POLLUTANT CONTROL 4.504.1 COVERING OF DUCT OPENINGS & PROTECTION OF MECHANICAL EQUIPMENT DURING CONSTRUCTION. At the time of rough installation, during storage on the construction site and until final startup of the heating, cooling and ventilating equipment, all duct and other related air distribution component openings shall be covered with tape, plastic, sheet metal or other methods acceptable to the enforcing agency to reduce the amount of water, dust or debris which may enter the system. 4.504.2 FINISH MATERIAL POLLUTANT CONTROL. Finish materials shall comply with this section. 4.504.2.1 Adhesives, Sealants and Caulks. Adhesives, sealant and caulks used on the project shall meet the requirements of the following standards unless more stringent local or regional air pollution or air quality management district rules apply: 1. Adhesives, adhesive bonding primers, adhesive primers, sealants, sealant primers and caulks shall comply with local or regional air pollution control or air quality management district rules where applicable or SCAQMD Rule 1168 VOC limits, as shown in Table 4.504.1 or 4.504.2, as applicable. Such products also shall comply with the Rule 1168 prohibition on the use of certain toxic compounds (chloroform, ethylene dichloride, methylene chloride, perchloroethylene and tricloroethylene), except for aerosol products, as specified in Subsection 2 below. 2. Aerosol adhesives, and smaller unit sizes of adhesives, and sealant or caulking compounds (in units of product, less packaging, which do not weigh more than 1 pound and do not consist of more than 16 fluid ounces) shall comply with statewide VOC standards and other requirements, including prohibitions on use of certain toxic compounds, of California Code of Regulations, Title 17, commencing with section 94507. 4.504.2.2 Paints and Coatings. Architectural paints and coatings shall comply with VOC limits in Table 1 of the ARB Architectural Suggested Control Measure, as shown in Table 4.504.3, unless more stringent local limits apply. The VOC content limit for coatings that do not meet the definitions for the specialty coatings categories listed in Table 4.504.3 shall be determined by classifying the coating as a Flat, Nonflat or Nonflat-High Gloss coating, based on its gloss, as defined in subsections 4.21, 4.36, and 4.37 of the 2007 California Air Resources Board, Suggested Control Measure, and the corresponding Flat, Nonflat or Nonflat-High Gloss VOC limit in Table 4.504.3 shall apply. 4.504.2.3 Aerosol Paints and Coatings. Aerosol paints and coatings shall meet the Product-weighted MIR Limits for ROC in Section 94522(a)(2) and other requirements, including prohibitions on use of certain toxic compounds and ozone depleting substances, in Sections 94522(e)(1) and (f)(1) of California Code of Regulations, Title 17, commencing with Section 94520; and in areas under the jurisdiction of the Bay Area Air Quality Management District additionally comply with the percent VOC by weight of product limits of Regulation 8, Rule 49. 4.504.2.4 Verification. Verification of compliance with this section shall be provided at the request of the enforcing agency. Documentation may include, but is not limited to, the following: 1. Manufacturer's product specification. 2. Field verification of on-site product containers. CHAPTER 7 INSTALLER & SPECIAL INSPECTOR QUALIFICATIONS 702 QUALIFICATIONS 702.1 INSTALLER TRAINING. HVAC system installers shall be trained and certified in the proper installation of HVAC systems including ducts and equipment by a nationally or regionally recognized training or certification program. Uncertified persons may perform HVAC installations when under the direct supervision and responsibility of a person trained and certified to install HVAC systems or contractor licensed to install HVAC systems. Examples of acceptable HVAC training and certification programs include but are not limited to the following: 1. State certified apprenticeship programs. 2. Public utility training programs. 3. Training programs sponsored by trade, labor or statewide energy consulting or verification organizations. 4. Programs sponsored by manufacturing organizations. 5. Other programs acceptable to the enforcing agency. 702.2 SPECIAL INSPECTION [HCD]. When required by the enforcing agency, the owner or the responsible entity acting as the owner's agent shall employ one or more special inspectors to provide inspection or other duties necessary to substantiate compliance with this code. Special inspectors shall demonstrate competence to the satisfaction of the enforcing agency for the particular type of inspection or task to be performed. In addition to other certifications or qualifications acceptable to the enforcing agency, the following certifications or education may be considered by the enforcing agency when evaluating the qualifications of a special inspector: 1. Certification by a national or regional green building program or standard publisher. 2. Certification by a statewide energy consulting or verification organization, such as HERS raters, building performance contractors, and home energy auditors. 3. Successful completion of a third party apprentice training program in the appropriate trade. 4. Other programs acceptable to the enforcing agency. Notes: 1. Special inspectors shall be independent entities with no financial interest in the materials or the project they are inspecting for compliance with this code. 2. HERS raters are special inspectors certified by the California Energy Commission (CEC) to rate homes in California according to the Home Energy Rating System (HERS). [BSC] When required by the enforcing agency, the owner or the responsible entity acting as the owner's agent shall employ one or more special inspectors to provide inspection or other duties necessary to substantiate compliance with this code. Special inspectors shall demonstrate competence to the satisfaction of the enforcing agency for the particular type of inspection or task to be performed. In addition, the special inspector shall have a certification from a recognized state, national or international association, as determined by the local agency. The area of certification shall be closely related to the primary job function, as determined by the local agency. Note: Special inspectors shall be independent entities with no financial interest in the materials or the project they are inspecting for compliance with this code. 703 VERIFICATIONS 703.1 DOCUMENTATION. Documentation used to show compliance with this code shall include but is not limited to, construction documents, plans, specifications, builder or installer certification, inspection reports, or other methods acceptable to the enforcing agency which demonstrate substantial conformance. When specific documentation or special inspection is necessary to verify compliance, that method of compliance will be specified in the appropriate section or identified applicable checklist. 4.505 INTERIOR MOISTURE CONTROL 4.505.1 General. Buildings shall meet or exceed the provisions of the California Building Standards Code. 4.505.2 CONCRETE SLAB FOUNDATIONS. Concrete slab foundations required to have a vapor retarder by California Building Code, Chapter 19, or concrete slab-on-ground floors required to have a vapor retarder by the California Residential Code, Chapter 5, shall also comply with this section. 4.505.2.1 Capillary break. A capillary break shall be installed in compliance with at least one of the following: 1. A 4-inch (101.6 mm) thick base of 1/2 inch (12.7mm) or larger clean aggregate shall be provided with a vapor barrier in direct contact with concrete and a concrete mix design, which will address bleeding, shrinkage, and curling, shall be used. For additional information, see American Concrete Institute, ACI 302.2R-06. 2. Other equivalent methods approved by the enforcing agency. 3. A slab design specified by a licensed design professional. 4.505.3 MOISTURE CONTENT OF BUILDING MATERIALS. Building materials with visible signs of water damage shall not be installed. Wall and floor framing shall not be enclosed when the framing members exceed 19 percent moisture content. Moisture content shall be verified in compliance with the following: 1. Moisture content shall be determined with either a probe-type or contact-type moisture meter.Equivalent moisture verification methods may be approved by the enforcing agency and shall satisfy requirements found in Section 101.8 of this code. 2. Moisture readings shall be taken at a point 2 feet (610 mm) to 4 feet (1219 mm) from the grade stamped end of each piece verified. 3. At least three random moisture readings shall be performed on wall and floor framing with documentation acceptable to the enforcing agency provided at the time of approval to enclose the wall and floor framing. Insulation products which are visibly wet or have a high moisture content shall be replaced or allowed to dry prior to enclosure in wall or floor cavities. Wet-applied insulation products shall follow the manufacturers' drying recommendations prior to enclosure. 4.506 INDOOR AIR QUALITY AND EXHAUST 4.506.1 Bathroom exhaust fans. Each bathroom shall be mechanically ventilated and shall comply with the following: 1. Fans shall be ENERGY STAR compliant and be ducted to terminate outside the building. 2. Unless functioning as a component of a whole house ventilation system, fans must be controlled by a humidity control. a. Humidity controls shall be capable of adjustment between a relative humidity range less than or equal to 50% to a maximum of 80%. A humidity control may utilize manual or automatic means of adjustment. b. A humidity control may be a separate component to the exhaust fan and is not required to be integral (i.e., built-in) Notes: 1. For the purposes of this section, a bathroom is a room which contains a bathtub, shower or tub/shower combination. 2. Lighting integral to bathroom exhaust fans shall comply with the California Energy Code. 4.507 ENVIRONMENTAL COMFORT 4.507.2 HEATING AND AIR-CONDITIONING SYSTEM DESIGN. Heating and air conditioning systems shall be sized, designed and have their equipment selected using the following methods: 1. The heat loss and heat gain is established according to ANSI/ACCA 2 Manual J - 2011 (Residential Load Calculation), ASHRAE handbooks or other equivalent design software or methods. 2. Duct systems are sized according to ANSI/ACCA 1 Manual D - 2014 (Residential Duct Systems), ASHRAE handbooks or other equivalent design software or methods. 3. Select heating and cooling equipment according to ANSI/ACCA 3 Manual S - 2014 (Residential Equipment Selection), or other equivalent design software or methods. Exception: Use of alternate design temperatures necessary to ensure the system functions are acceptable. TABLE 4.504.1 - ADHESIVE VOC LIMIT1,2 (Less Water and Less Exempt Compounds in Grams per Liter) ARCHITECTURAL APPLICATIONS VOC LIMIT INDOOR CARPET ADHESIVES 50 CARPET PAD ADHESIVES 50 OUTDOOR CARPET ADHESIVES 150 WOOD FLOORING ADHESIVES 100 RUBBER FLOOR ADHESIVES 60 SUBFLOOR ADHESIVES 50 CERAMIC TILE ADHESIVES 65 VCT & ASPHALT TILE ADHESIVES 50 DRYWALL & PANEL ADHESIVES 50 COVE BASE ADHESIVES 50 MULTIPURPOSE CONSTRUCTION ADHESIVE 70 STRUCTURAL GLAZING ADHESIVES 100 SINGLE-PLY ROOF MEMBRANE ADHESIVES 250 OTHER ADHESIVES NOT LISTED 50 SPECIALTY APPLICATIONS PVC WELDING 510 CPVC WELDING 490 ABS WELDING 325 PLASTIC CEMENT WELDING 250 ADHESIVE PRIMER FOR PLASTIC 550 CONTACT ADHESIVE 80 SPECIAL PURPOSE CONTACT ADHESIVE 250 STRUCTURAL WOOD MEMBER ADHESIVE 140 TOP & TRIM ADHESIVE 250 SUBSTRATE SPECIFIC APPLICATIONS METAL TO METAL 30 PLASTIC FOAMS 50 POROUS MATERIAL (EXCEPT WOOD)50 WOOD 30 FIBERGLASS 80 1. IF AN ADHESIVE IS USED TO BOND DISSIMILAR SUBSTRATES TOGETHER, THE ADHESIVE WITH THE HIGHEST VOC CONTENT SHALL BE ALLOWED. 2. FOR ADDITIONAL INFORMATION REGARDING METHODS TO MEASURE THE VOC CONTENT SPECIFIED IN THIS TABLE, SEE SOUTH COAST AIR QUALITY MANAGEMENT DISTRICT RULE 1168. TABLE 4.504.2 - SEALANT VOC LIMIT (Less Water and Less Exempt Compounds in Grams per Liter) SEALANTS VOC LIMIT ARCHITECTURAL 250 MARINE DECK 760 NONMEMBRANE ROOF 300 ROADWAY 250 SINGLE-PLY ROOF MEMBRANE 450 OTHER 420 SEALANT PRIMERS ARCHITECTURAL NON-POROUS 250 POROUS 775 MODIFIED BITUMINOUS 500 MARINE DECK 760 OTHER 750 TABLE 4.504.5 - FORMALDEHYDE LIMITS1 MAXIMUM FORMALDEHYDE EMISSIONS IN PARTS PER MILLION PRODUCT CURRENT LIMIT HARDWOOD PLYWOOD VENEER CORE 0.05 HARDWOOD PLYWOOD COMPOSITE CORE 0.05 PARTICLE BOARD 0.09 MEDIUM DENSITY FIBERBOARD 0.11 THIN MEDIUM DENSITY FIBERBOARD2 0.13 1. VALUES IN THIS TABLE ARE DERIVED FROM THOSE SPECIFIED BY THE CALIF. AIR RESOURCES BOARD, AIR TOXICS CONTROL MEASURE FOR COMPOSITE WOOD AS TESTED IN ACCORDANCE WITH ASTM E 1333. FOR ADDITIONAL INFORMATION, SEE CALIF. CODE OF REGULATIONS, TITLE 17, SECTIONS 93120 THROUGH 93120.12. 2. THIN MEDIUM DENSITY FIBERBOARD HAS A MAXIMUM THICKNESS OF 5/16" (8 MM). TABLE 4.504.3 - VOC CONTENT LIMITS FOR ARCHITECTURAL COATINGS2,3 GRAMS OF VOC PER LITER OF COATING, LESS WATER & LESS EXEMPT COMPOUNDS COATING CATEGORY VOC LIMIT FLAT COATINGS 50 NON-FLAT COATINGS 100 NONFLAT-HIGH GLOSS COATINGS 150 SPECIALTY COATINGS ALUMINUM ROOF COATINGS 400 BASEMENT SPECIALTY COATINGS 400 BITUMINOUS ROOF COATINGS 50 BITUMINOUS ROOF PRIMERS 350 BOND BREAKERS 350 CONCRETE CURING COMPOUNDS 350 CONCRETE/MASONRY SEALERS 100 DRIVEWAY SEALERS 50 DRY FOG COATINGS 150 FAUX FINISHING COATINGS 350 FIRE RESISTIVE COATINGS 350 FLOOR COATINGS 100 FORM-RELEASE COMPOUNDS 250 GRAPHIC ARTS COATINGS (SIGN PAINTS)500 HIGH TEMPERATURE COATINGS 420 INDUSTRIAL MAINTENANCE COATINGS 250 LOW SOLIDS COATINGS1 120 MAGNESITE CEMENT COATINGS 450 MASTIC TEXTURE COATINGS 100 METALLIC PIGMENTED COATINGS 500 MULTICOLOR COATINGS 250 PRETREATMENT WASH PRIMERS 420 PRIMERS, SEALERS, & UNDERCOATERS 100 REACTIVE PENETRATING SEALERS 350 RECYCLED COATINGS 250 ROOF COATINGS 50 RUST PREVENTATIVE COATINGS 250 SHELLACS CLEAR 730 OPAQUE 550 SPECIALTY PRIMERS, SEALERS & UNDERCOATERS 100 STAINS 250 STONE CONSOLIDANTS 450 SWIMMING POOL COATINGS 340 TRAFFIC MARKING COATINGS 100 TUB & TILE REFINISH COATINGS 420 WATERPROOFING MEMBRANES 250 WOOD COATINGS 275 WOOD PRESERVATIVES 350 ZINC-RICH PRIMERS 340 1. GRAMS OF VOC PER LITER OF COATING, INCLUDING WATER & EXEMPT COMPOUNDS 2. THE SPECIFIED LIMITS REMAIN IN EFFECT UNLESS REVISED LIMITS ARE LISTED IN SUBSEQUENT COLUMNS IN THE TABLE. 3. VALUES IN THIS TABLE ARE DERIVED FROM THOSE SPECIFIED BY THE CALIFORNIA AIR RESOURCES BOARD, ARCHITECTURAL COATINGS SUGGESTED CONTROL MEASURE, FEB. 1, 2008. MORE INFORMATION IS AVAILABLE FROM THE AIR RESOURCES BOARD. DIVISION 4.5 ENVIRONMENTAL QUALITY (continued) 4.504.3 CARPET SYSTEMS. All carpet installed in the building interior shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. https://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.3.1 Carpet cushion. All carpet cushion installed in the building interior shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. https://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.3.2 Carpet adhesive. All carpet adhesive shall meet the requirements of Table 4.504.1. 4.504.4 RESILIENT FLOORING SYSTEMS. Where resilient flooring is installed , at least 80% of floor area receiving resilient flooring shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. hhtps://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.5 COMPOSITE WOOD PRODUCTS. Hardwood plywood, particleboard and medium density fiberboard composite wood products used on the interior or exterior of the buildings shall meet the requirements for formaldehyde as specified in ARB's Air Toxics Control Measure for Composite Wood (17 CCR 93120 et seq.), by or before the dates specified in those sections, as shown in Table 4.504.5 4.504.5.1 Documentation. Verification of compliance with this section shall be provided as requested by the enforcing agency. Documentation shall include at least one of the following: 1. Product certifications and specifications. 2. Chain of custody certifications. 3. Product labeled and invoiced as meeting the Composite Wood Products regulation (see CCR, Title 17, Section 93120, et seq.). 4. Exterior grade products marked as meeting the PS-1 or PS-2 standards of the Engineered Wood Association, the Australian AS/NZS 2269, European 636 3S standards, and Canadian CSA 0121, CSA 0151, CSA 0153 and CSA 0325 standards. 5. Other methods acceptable to the enforcing agency. DISCLAIMER:THIS DOCUMENT IS PROVIDED AND INTENDED TO BE USED AS A MEANS TO INDICATE AREAS OF COMPLIANCE WITH THE CALIFORNIA GREEN BUILDING STANDARDS (CALGREEN) CODE. DUE TO THE VARIABLES BETWEEN BUILDING DEPARTMENT JURISDICTIONS, THIS CHECKLIST IS TO BE USED ON AN INDIVIDUAL PROJECT BASIS AND MAY BE MODIFIED BY THE END USER TO MEET THOSE INDIVIDUAL NEEDS. THE END USER ASSUMES ALL RESPONSIBILITY ASSOCIATED WITH THE USE OF THIS DOCUMENT, INCLUDING VERIFICATION WITH THE FULL CODE. Y N/AYN/AYN/AYN/A RESPON. PARTY RESPON. PARTY RESPON. PARTY RESPON. PARTY 2022 CALIFORNIA GREEN BUILDING STANDARDS CODE RESIDENTIAL MANDATORY MEASURES, SHEET 2 (January 2023)Y = YES N/A =NOT APPLICABLE RESPON. PARTY =RESPONSIBLE PARTY (ie: ARCHITECT, ENGINEER, OWNER, CONTRACTOR, INSPECTOR ETC.) 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 T-24-1T-24-1 ADU Conversion 1123 Magnolia Ave Santa Ana, Ca 92707 1123 S Magnolia Ave Unit# 22/19/2025 T-24-2 Pages from 17-001-1-1.jpg Pages from 17-001-1-1.jpg ADU Conversion 1123 Magnolia Ave Santa Ana, Ca 92707 Frank Solis Frank Solis 5868 Agra St Bell Gardens, CA 90201 Frank Solis 562.685.1171 1123 S Magnolia Ave Unit# 22/19/2025 T-24-3 2022 Single-Family Residential Mandatory Requirements Summary NOTE: Single-family residential buildings subject to the Energy Codes must comply with all applicable mandatory measures, regardless of the compliance approach used. Review the respective section for more information. (04/2022) Building Envelope: D D E D J L M D E F G I J J T Air Leakage. Manufactured fenestration, exterior doors, and exterior pet doors must limit air leakage to 0.3 CFM per square foot or less when tested per NFRC-400, ASTM E283, or AAMA/WDMA/CSA 101/I.S.2/A440-2011. * /DEHOLQJ)HQHVWUDWLRQSURGXFWVDQGH[WHULRUGRRUVPXVWKDYHDODEHOPHHWLQJWKHUHTXLUHPHQWVRID Field fabricated exterior doors and fenestration products must use U-factors and solar heat gain coefficient (SHGC) values from Tables 110.6-A, 110.6-B, or JA4.5 for exterior doors. They must be caulked and/or weather-stripped. * Air Leakage. All joints, penetrations, and other openings in the building envelope that are potential sources of air leakage must be caulked, gasketed, or weather stripped. Insulation Certification by Manufacturers. Insulation must be certified by the Department of Consumer Affairs, Bureau of Household Goods and Services (BHGS). ,QVXODWLRQ5HTXLUHPHQWVIRU+HDWHG6ODE)ORRUV+HDWHGVODEIORRUVPXVWEHLQVXODWHGSHUWKHUHTXLUHPHQWVRIJ Roofing Products Solar Reflectance and Thermal Emittance. The thermal emittance and aged solar reflectance values of the URRILQJPDWHULDOPXVWPHHWWKHUHTXLUHPHQWVRILDQGEHODEHOHGSHUZKHQWKHLQVWDOODWLRQRIDFRROURRILVVSHFLILHG on the CF1R. Radiant Barrier. When required, radiant barriers must have an emittance of 0.05 or less and be certified to the Department of Consumer Affairs. Roof Deck, Ceiling and Rafter Roof Insulation. Roof decks in newly constructed attics in climate zones 4 and 8-16 area-weighted average U-factor not exceeding U-0.184. Ceiling and rafter roofs minimum R-22 insulation in wood-frame ceiling; or area-weighted average U-factor must not exceed 0.043. Rafter roof alterations minimum R-19 or area-weighted average U-factor of 0.054 or less. Attic access doors must have permanently attached insulation using adhesive or mechanical fasteners. The attic access must be gasketed to prevent air leakage. Insulation must be installed in direct contact with a roof or ceiling which is sealed to limit infiltration and exfiltration DVVSHFLILHGLQLQFOXGLQJEXWQRWOLPLWHGWRSODFLQJLQVXODWLRQHLWKHUDERYHRUEHORZWKHURRIGHFNRURQWRSRIDGU\ZDOOFHLOLQJ /RRVHILOO,QVXODWLRQ/RRVHILOOLQVXODWLRQPXVWPHHWWKHPDQXIDFWXUHU¶VUHTXLUHGGHQVLW\IRUWKHODEHOHG5YDOXH Wall Insulation. Minimum R-13 insulation in 2x4 inch wood framing wall or have a U-factor of 0.102 or less, or R-20 in 2x6 inch wood framing or have a U-factor of 0.071 or less. Opaque non-framed assemblies must have an overall assembly U-factor not exceeding 0.102. Masonry walls must meet Tables 150.1-A or B. * Raised-floor Insulation. Minimum R-19 insulation in raised wood framed floor or 0.037 maximum U-factor. * Slab Edge Insulation. Slab edge insulation must meet all of the following: have a water absorption rate, for the insulation material alone without facings, no greater than 0.3 percent; have a water vapor permeance no greater than 2.0 perm per inch; be protected from SK\VLFDOGDPDJHDQG89OLJKWGHWHULRUDWLRQDQGZKHQLQVWDOOHGDVSDUWRIDKHDWHGVODEIORRUPHHWWKHUHTXLUHPHQWVRIJ Vapor Retarder. In climate zones 1 through 16, the earth floor of unvented crawl space must be covered with a Class I or Class II vapor retarder. This requirement also applies to controlled ventilation crawl space for buildings complying with the exception to G Vapor Retarder. In climate zones 14 and 16, a Class I or Class II vapor retarder must be installed on the conditioned space side of all insulation in all exterior walls, vented attics, and unvented attics with air-permeable insulation. Fenestration Products. Fenestration, including skylights, separating conditioned space from unconditioned space or outdoors must have a maximum U-factor of 0.45; or area-weighted average U-factor of all fenestration must not exceed 0.45. * Fireplaces, Decorative Gas Appliances, and Gas Log: H H H H Pilot Light. Continuously burning pilot lights are not allowed for indoor and outdoor fireplaces. Closable Doors. Masonry or factory-built fireplaces must have a closable metal or glass door covering the entire opening of the firebox. Combustion Intake. Masonry or factory-built fireplaces must have a combustion outside air intake, which is at least six square inches in area and is equipped with a readily accessible, operable, and tight-fitting damper or combustion-air control device. * Flue Damper. Masonry or factory-built fireplaces must have a flue damper with a readily accessible control. * Space Conditioning, Water Heating, and Plumbing System: D E F F F 5/6/22 Certification. Heating, ventilation, and air conditioning (HVAC) equipment, water heaters, showerheads, faucets, and all other regulated appliances must be certified by the manufacturer to the California Energy Commission. * HVAC Efficiency. Equipment must meet the applicable efficiency requirements in Table 110.2-A through Table 110.2-N. * Controls for Heat Pumps with Supplementary Electric Resistance Heaters. Heat pumps with supplementary electric resistance heaters must have controls that prevent supplementary heater operation when the heating load can be met by the heat pump alone; and in which the cut-on temperature for compression heating is higher than the cut-on temperature for supplementary heating, and the cut-off temperature for compression heating is higher than the cut-off temperature for supplementary heating. * Thermostats. All heating or cooling systems not controlled by a central energy management control system (EMCS) must have a setback thermostat. * Insulation. Unfired service water heater storage tanks and solar water-heating backup tanks must have adequate insulation, or tank surface heat loss rating. Isolation Valves. Instantaneous water heaters with an input rating greater than 6.8 kBtu per hour (2 kW) must have isolation valves with hose bibbs or other fittings on both cold and hot water lines to allow for flushing the water heater when the valves are closed. 2022 Single-Family Residential Mandatory Requirements Summary K K$ K% M M Pilot Lights. Continuously burning pilot lights are prohibited for natural gas: fan-type central furnaces; household cooking appliances (except appliances without an electrical supply voltage connection with pilot lights that consume less than 150 Btu per hour ); and pool and spa heaters. * Building Cooling and Heating Loads. Heating and/or cooling loads are calculated in accordance with the ASHRAE Handbook, Equipment Volume, Applications Volume, and Fundamentals Volume; the SMACNA Residential Comfort System Installation 6WDQGDUGV0DQXDORUWKH$&&$0DQXDO-XVLQJGHVLJQFRQGLWLRQVVSHFLILHGLQK Clearances. Air conditioner and heat pump outdoor condensing units must have a clearance of at least five feet from the outlet of any dryer. Liquid Line Drier. Air conditioners and heat pump systems must be equipped with liquid line filter driers if required, as specified by the PDQXIDFWXUHU¶VLQVWUXFWLRQV Water Piping, Solar Water-heating System Piping, and Space Conditioning System Line Insulation. All domestic hot water SLSLQJPXVWEHLQVXODWHGDVVSHFLILHGLQRIWKH&DOLIRUQLD3OXPELQJ&RGH Insulation Protection. Piping insulation must be protected from damage, including that due to sunlight, moisture, equipment` PDLQWHQDQFHDQGZLQGDVUHTXLUHGE\E,QVXODWLRQH[SRVHGWRZHDWKHUPXVWEHZDWHUUHWDUGDQWDQGSURWHFWHGIURP89OLJKWQR adhesive tapes). Insulation covering chilled water piping and refrigerant suction piping located outside the conditioned space must include, or be protected by, a Class I or Class II vapor retarder. Pipe insulation buried below grade must be installed in a waterproof and non-crushable casing or sleeve. Q Q Ducts and Fans: G Gas or Propane Water Heating Systems. Systems using gas or propane water heaters to serve individual dwelling units must GHVLJQDWHDVSDFHDWOHDVW¶[¶[¶VXLWDEOHIRUWKHIXWXUHLQVWDOODWLRQRIDKHDWSXPSZDWHUKHDWHUDQGPHHWHOHFWULFDODQG plumbing requirements, based on the distance between this designated space and the water heater location; and a condensate drain no PRUHWKDQ´KLJKHUWKDQWKHEDVHRIWKHZDWHUKHDWHU Solar Water-heating Systems. Solar water-heating systems and collectors must be certified and rated by the Solar Rating and Certification Corporation (SRCC), the International Association of Plumbing and Mechanical Officials, Research and Testing (IAPMO R&T), or by a listing agency that is approved by the executive director. 'XFWV,QVXODWLRQLQVWDOOHGRQDQH[LVWLQJVSDFHFRQGLWLRQLQJGXFWPXVWFRPSO\ZLWKRIWKH&DOLIRUQLD0HFKDQLFDO&RGH&0&,ID contractor installs the insulation, the contractor must certify to the customer, in writing, that the insulation meets this requirement. P &0&&RPSOLDQFH$OODLUGLVWULEXWLRQV\VWHPGXFWVDQGSOHQXPVPXVWPHHW&0&DQG$16,60$&1$+9$& Duct Construction Standards Metal and Flexible 3rd Edition. Portions of supply-air and return-air ducts and plenums must be insulated to R-6.0 or higher; ducts located entirely in conditioned space as confirmed through field verification and diagnostic testing (RA3.1.4.3.8) do not require insulation. Connections of metal ducts and inner core of flexible ducts must be mechanically fastened. Openings must be sealed with mastic, tape, or other duct-closure system that meets the applicable UL requirements, or aerosol sealant that meets UL 723. 7KHFRPELQDWLRQRIPDVWLFDQGHLWKHUPHVKRUWDSHPXVWEHXVHGWRVHDORSHQLQJVJUHDWHUWKDQó´,IPDVWLFRUWDSHLVXVHG%XLOGLQJ cavities, air handler support platforms, and plenums designed or constructed with materials other than sealed sheet metal, duct board or flexible duct must not be used to convey conditioned air. Building cavities and support platforms may contain ducts; ducts installed in these spaces must not be compressed. * P P P P P P P P Factory-Fabricated Duct Systems. Factory-fabricated duct systems must comply with applicable requirements for duct construction, connections, and closures; joints and seams of duct systems and their components must not be sealed with cloth back rubber adhesive duct tapes unless such tape is used in combination with mastic and draw bands. Field-Fabricated Duct Systems. Field-fabricated duct systems must comply with applicable requirements for: pressure-sensitive tapes, mastics, sealants, and other requirements specified for duct construction. Backdraft Damper. Fan systems that exchange air between the conditioned space and outdoors must have backdraft or automatic dampers. Gravity Ventilation Dampers. Gravity ventilating systems serving conditioned space must have either automatic or readily accessible, manually operated dampers in all openings to the outside, except combustion inlet and outlet air openings and elevator shaft vents. Protection of Insulation. Insulation must be protected from damage due tosunlight, moisture, equipment maintenance, and wind. Insulation exposed to weather must be suitable for outdoor service (e.g., protected by aluminum, sheet metal, painted canvas, or plastic cover). Cellular foam insulation must be protected as above or painted with a water retardant and solar radiation-resistant coating. Porous Inner Core Flex Duct. Porous inner cores of flex ducts must have a non-porous layer or air barrier between the inner core and outer vapor barrier. Duct System Sealing and Leakage Test. When space conditioning systems use forced air duct systems to supply conditioned air to an occupiable space, the ducts must be sealed and duct leakage tested, as confirmed through field verification and diagnostic testing, in accordance with Reference Residential Appendix RA3.1. Air Filtration. Space conditioning systems with ducts exceeding 10 feet and the supply side of ventilation systems must have MERV 13 or equivalent filters. Filters for space conditioning systems must have a two inch depth or can be one inch if sized per Equation 150.0-A. &OHDQILOWHUSUHVVXUHGURSDQGODEHOLQJPXVWPHHWWKHUHTXLUHPHQWVLQP)LOWHUVPXVWEHDFFHVVLEOHIRUUHJXODUVHUYLFH)LOWHU racks or grilles must use gaskets, sealing, or other means to close gaps around the inserted filters to and prevents air from bypassing the filter. * 5/6/22 2022 Single-Family Residential Mandatory Requirements Summary P Space Conditioning System Airflow Rate and Fan Efficacy. Space conditioning systems that use ducts to supply cooling must have a hole for the placement of a static pressure probe, or a permanently installed static pressure probe in the supply plenum. Airflow must EH&)0SHUWRQRIQRPLQDOFRROLQJFDSDFLW\DQGDQDLUKDQGOLQJXQLWIDQHIILFDF\ZDWWVSHU&)0IRUJDVIXUQDFHDLU KDQGOHUVDQGZDWWVSHU&)0IRUDOORWKHUV6PDOOGXFWKLJKYHORFLW\V\VWHPVPXVWSURYLGHDQDLUIORZ&)0SHUWRQRIQRPLQDO FRROLQJFDSDFLW\DQGDQDLUKDQGOLQJXQLWIDQHIILFDF\ZDWWVSHU&)0)LHOGYHULILFDWLRQWHVWLQJLVUHTXLUHGLQDFFRUGDQFHZLWK Reference Residential Appendix RA3.3. * Ventilation and Indoor Air Quality: R R% Requirements for Ventilation and Indoor Air Quality. All dwelling units must meet the requirements of ASHRAE Standard 62.2, 9HQWLODWLRQDQG$FFHSWDEOH,QGRRU$LU4XDOLW\LQ5HVLGHQWLDO%XLOGLQJVVXEMHFWWRWKHDPHQGPHQWVVSHFLILHGLQR Central Fan Integrated (CFI) Ventilation Systems. Continuous operation of CFI air handlers is not allowed to provide the whole- GZHOOLQJXQLWYHQWLODWLRQDLUIORZUHTXLUHGSHUR&$PRWRUL]HGGDPSHUVPXVWEHLQVWDOOHGRQWKHYHQWLODWLRQGXFWVWKDW SUHYHQWVDOODLUIORZWKURXJKWKHVSDFHFRQGLWLRQLQJGXFWV\VWHPZKHQWKHGDPSHUVLVFORVHGDQGFRQWUROOHGSHUR%LLL LY&), ventilation systems must have controls that track outdoor air ventilation run time, and either open or close the motorized damper(s) for FRPSOLDQFHZLWKR& R& R* Whole-Dwelling Unit Mechanical Ventilation for Single-Family Detached and townhouses . Single-family detached dwelling units, and attached dwelling units not sharing ceilings or floors with other dwelling units, occupiable spaces, public garages, or commercial VSDFHVPXVWKDYHPHFKDQLFDOYHQWLODWLRQDLUIORZVSHFLILHGLQR&LLLL Local Mechanical Exhaust. Kitchens and bathrooms must have local mechanical exhaust; nonenclosed kitchens must have demand- FRQWUROOHGH[KDXVWV\VWHPPHHWLQJUHTXLUHPHQWVRIR*LLLHQFORVHGNLWFKHQVDQGEDWKURRPVFDQXVHGHPDQGFRQWUROOHGRU FRQWLQXRXVH[KDXVWPHHWLQJR*LLLLY$LUIORZPXVWEHPHDVXUHGE\WKHLQVWDOOHUSHUR*YDQGUDWHGIRUVRXQGSHU R*YL R+ ,$LUIORZ0HDVXUHPHQWDQG6RXQG5DWLQJVRI:KROH'ZHOOLQJ8QLW9HQWLODWLRQ6\VWHPV7KHDLUIORZUHTXLUHGSHUR&PXVW EHPHDVXUHGE\XVLQJDIORZKRRGIORZJULGRURWKHUDLUIORZPHDVXULQJGHYLFHDWWKHIDQ¶VLQOHWRURXWOHWWHUPLQDOVJULOOHVSHU5HIHUHQFH 5HVLGHQWLDO$SSHQGL[5$:KROH'ZHOOLQJXQLWYHQWLODWLRQV\VWHPVPXVWEHUDWHGIRUVRXQGSHU$6+5$(DWQROHVVWKDQWKH PLQLPXPDLUIORZUDWHUHTXLUHGE\R& R Field Verification and Diagnostic Testing. Whole-Dwelling Unit ventilation airflow, vented range hood airflow and sound rating, and HRV and ERV fan efficacy must be verified in accordance with Reference Residential Appendix RA3.7. Vented range hoods must be verified per Reference Residential Appendix RA3.7.4.3 to confirm if it is rated by HVI or AHAM to comply with the airflow UDWHVDQGVRXQGUHTXLUHPHQWVSHUR* Pool and Spa Systems and Equipment: D E E E S Lighting: N$ N% N& N' N( N) 5/6/22 Certification by Manufacturers. Any pool or spa heating system or equipment must be certified to have all of the following: compliance with the Appliance Efficiency Regulations and listing in MAEDbS; an on-off switch mounted outside of the heater that allows shutting off the heater without adjusting the thermostat setting; a permanent weatherproof plate or card with operating instructions; and must not use electric resistance heating. * Piping. Any pool or spa heating system or equipment must be installed with at least 36 inches of pipe between the filter and the heater, or dedicated suction and return lines, or built-in or built-up connections to allow for future solar heating. Covers. Outdoor pools or spas that have a heat pump or gas heater must have a cover. Directional Inlets and Time Switches for Pools. Pools must have directional inlets that adequately mix the pool water, and a time switch that will allow all pumps to be set or programmed to run only during off-peak electric demand periods. Pilot Light. Natural gas pool and spa heaters must not have a continuously burning pilot light. Pool Systems and Equipment Installation. Residential pool systems or equipment must meet the specified requirements for pump sizing, flow rate, piping, filters, and valves. * Lighting Controls and Components. All lighting control devices and systems, ballasts, and luminaires must meet the applicable UHTXLUHPHQWVRI Luminaire Efficacy. All installed luminaires must meet the requirements in Table 150.0-A, except lighting integral to exhaust fans, kitchen range hoods, bath vanity mirrors, and garage door openers; navigation lighting less than 5 watts; and lighting internal to drawers, cabinets, and linen closets with an efficacy of at least 45 lumens per watt. Screw based luminaires. Screw based luminaires must contain lamps that comply with Reference Joint Appendix JA8. * Recessed Downlight Luminaires in Ceilings. Luminaires recessed into ceilings must not contain screw based sockets, must be airtight, DQGPXVWEHVHDOHGZLWKDJDVNHWRUFDXON&DOLIRUQLD(OHFWULFDO&RGHPXVWDOVREHPHW Light Sources in Enclosed or Recessed Luminaires. Lamps and other separable light sources that are not compliant with the JA8 elevated temperature requirements, including marking requirements, must not be installed in enclosed or recessed luminaires. Blank Electrical Boxes. The number of electrical boxes that are more than five feet above the finished floor and do not contain a luminaire or other device shall be no more than the number of bedrooms. These boxes must be served by a dimmer, vacancy sensor control, low voltage wiring, or fan speed control. Lighting Integral to Exhaust Fans. Lighting integral to exhaust fans (except when installed by the manufacturer in kitchen exhaust KRRGVPXVWPHHWWKHDSSOLFDEOHUHTXLUHPHQWVRIN N* N+ N, N$ N% N$ N% N& N' N( N) N. N$ N N Solar Readiness: D 2022 Single-Family Residential Mandatory Requirements Summary Screw based luminaires. Screw based luminaires must contain lamps that comply with Reference Joint Appendix JA8. * Light Sources in Enclosed or Recessed Luminaires. Lamps and other separable light sources that are not compliant with the JA8 elevated temperature requirements, including marking requirements, must not be installed in enclosed or recessed luminaires. Light Sources in Drawers, Cabinets, and Linen Closets. Light sources internal to drawers, cabinetry or linen closets are not required to comply with Table 150.0-A or be controlled by vacancy sensors provided that they are rated to consume no more than 5 watts of power, emit no more than 150 lumens, and are equipped with controls that automatically turn the lighting off when the drawer, cabinet or linen closet is closed. Interior Switches and Controls. All forward phase cut dimmers used with LED light sources must comply with NEMA SSL 7A. Interior Switches and Controls. Exhaust fans must be controlled separately from lighting systems. * Accessible Controls. Lighting must have readily accessible wall-mounted controls that allow the lighting to be manually turned on and off. * Multiple Controls. Controls must not bypass a dimmer, occupant sensor, or vacancy sensor function if the dimmer or sensor is installed WRFRPSO\ZLWKN 0DQGDWRU\5HTXLUHPHQWV/LJKWLQJFRQWUROVPXVWFRPSO\ZLWKWKHDSSOLFDEOHUHTXLUHPHQWVRI Energy Management Control Systems. An energy management control system (EMCS) may be used to comply with dimming, RFFXSDQF\DQGFRQWUROUHTXLUHPHQWVLILWSURYLGHVWKHIXQFWLRQDOLW\RIWKHVSHFLILHGFRQWUROSHUDQGWKHSK\VLFDOFRQWUROVVSHFLILHG LQN$ Automatic Shutoff Controls. In bathrooms, garages, laundry rooms, utility rooms and walk-in closets, at least one installed luminaire must be controlled by an occupancy or vacancy sensor providing automatic-off functionality. Lighting inside drawers and cabinets with opaque fronts or doors must have controls that turn the light off when the drawer or door is closed. Dimmers. Lighting in habitable spaces (e.g., living rooms, dining rooms, kitchens, and bedrooms) must have readily accessible wall- mounted dimming controls that allow the lighting to be manually adjusted up and down. Forward phase cut dimmers controlling LED light sources in these spaces must comply with NEMA SSL 7A. Independent controls. Integrated lighting of exhaust fans shall be controlled independently from the fans. Lighting under cabinets or shelves, lighting in display cabinets, and switched outlets must be controlled separately from ceiling-installed lighting. Residential Outdoor Lighting. For single-family residential buildings, outdoor lighting permanently mounted to a residential building, or to other buildings on the same lot, must have a manual on/off switch and either a photocell and motion sensor or automatic time switch control) or an astronomical time clock. An energy management control system that provides the specified control functionality and meets all applicable requirements may be used to meet these requirements. ,QWHUQDOO\LOOXPLQDWHGDGGUHVVVLJQV,QWHUQDOO\LOOXPLQDWHGDGGUHVVVLJQVPXVWHLWKHUFRPSO\ZLWKRUFRQVXPHQRPRUHWKDQ watts of power. Residential Garages for Eight or More Vehicles. Lighting for residential parking garages for eight or more vehicles must comply with the DSSOLFDEOHUHTXLUHPHQWVIRUQRQUHVLGHQWLDOJDUDJHVLQDQG Single-family Residences. Single-family residences located in subdivisions with 10 or more single-family residences and where the application for a tentative subdivision map for the residences has been deemed complete and approved by the enforcement agency, ZKLFKGRQRWKDYHDSKRWRYROWDLFV\VWHPLQVWDOOHGPXVWFRPSO\ZLWKWKHUHTXLUHPHQWVRIEH E$ E E$ E% E F G H H Minimum Solar Zone Area. The solar zone must have a minimum total area as described below. The solar zone must comply with access, pathway, smoke ventilation, and spacing requirements as specified in Title 24, Part 9 or other parts of Title 24 or in any requirements adopted by a local jurisdiction. The solar zone total area must be comprised of areas that have no dimension less than 5 feet and are no less than 80 square feet each for buildings with roof areas less than or equal to 10,000 square feet or no less than 160 square feet each for buildings with roof areas greater than 10,000 square feet. For single-family residences, the solar zone must be located on the roof or overhang of the building and have a total area no less than 250 square feet. * $]LPXWK$OOVHFWLRQVRIWKHVRODU]RQHORFDWHGRQVWHHSVORSHGURRIVPXVWKDYHDQD]LPXWKEHWZHHQRIWUXHQRUWK Shading. The solar zone must not contain any obstructions, including but not limited to: vents, chimneys, architectural features, and roof mounted equipment. * Shading. Any obstruction located on the roof or any other part of the building that projects above a solar zone must be located at least twice the horizontal distance of the height difference between the highest point of the obstruction and the horizontal projection of the nearest point of the solar zone, measured in the vertical plane. * Structural Design Loads on Construction Documents. For areas of the roof designated as a solar zone, the structural design loads for roof dead load and roof live load must be clearly indicated on the construction documents. Interconnection Pathways. The construction documents must indicate: a location reserved for inverters and metering equipment and a pathway reserved for routing of conduit from the solar zone to the point of interconnection with the electrical service; and for single-family residences and central water-heating systems, a pathway reserved for routing plumbing from the solar zone to the water-heating system. 'RFXPHQWDWLRQ$FRS\RIWKHFRQVWUXFWLRQGRFXPHQWVRUDFRPSDUDEOHGRFXPHQWLQGLFDWLQJWKHLQIRUPDWLRQIURPEFPXVWEH provided to the occupant. Main Electrical Service Panel. The main electrical service panel must have a minimum busbar rating of 200 amps. Main Electrical Service Panel. The main electrical service panel must have a reserved space to allow for the installation of a double pole FLUFXLWEUHDNHUIRUDIXWXUHVRODUHOHFWULFLQVWDOODWLRQ7KHUHVHUYHGVSDFHPXVWEHSHUPDQHQWO\PDUNHGDV³)RU)XWXUH6RODU(OHFWULF´ Electric and Energy Storage Ready: 5/6/22 2022 Single-Family Residential Mandatory Requirements Summary Energy Storage System (ESS) Ready. All single-family residences must meet all of the following: Either ESS-ready interconnection equipment with backed up capacity of 60 amps or more and four or more ESS supplied branch circuits, or a dedicated raceway from the PDLQVHUYLFHWRDVXESDQHOWKDWVXSSOLHVWKHEUDQFKFLUFXLWVLQVDWOHDVWIRXUEUDQFKFLUFXLWVPXVWEHLGHQWLILHGDQGKDYHWKHLU source collocated at a single panelboard suitable to be supplied by the ESS, with one circuit supplying the refrigerator, one lighting circuit near the primary exit, and one circuit supplying a sleeping room receptacle outlet; main panelboard must have a minimum busbar rating of DPSVVXIILFLHQWVSDFHPXVWEHUHVHUYHGWRDOORZIXWXUHLQVWDOODWLRQRIDV\VWHPLVRODWLRQHTXLSPHQWWUDQVIHUVZLWFKZLWKLQ¶RIWKHPDLQ panelboard, with raceways installed between the panelboard and the switch location to allow the connection of backup power source. Heat Pump Space Heater Ready. Systems using gas or propane furnaces to serve individual dwelling units must include: A dedicated XQREVWUXFWHG9EUDQFKFLUFXLWZLULQJLQVWDOOHGZLWKLQ¶RIWKHIXUQDFHZLWKFLUFXLWFRQGXFWRUVUDWHGDWOHDVWDPSVZLWKWKHEODQNFRYHU LGHQWLILHGDV³9UHDG\´DQGDUHVHUYHGPDLQHOHFWULFDOVHUYLFHSDQHOVSDFHWRDOORZIRUWKHLQVWDOODWLRQRIDGRXEOHSROHFLUFXLWEUHDNHU SHUPDQHQWO\PDUNHGDV³)RU)XWXUH9XVH´ Electric Cooktop Ready. Systems using gas or propane cooktop to serve individual dwelling units must include: A dedicated unobstructed 9EUDQFKFLUFXLWZLULQJLQVWDOOHGZLWKLQ¶RIWKHFRRNWRSZLWKFLUFXLWFRQGXFWRUVUDWHGDWOHDVWDPSVZLWKWKHEODQNFRYHULGHQWLILHGDV ³9UHDG\´DQGDUHVHUYHGPDLQHOHFWULFDOVHUYLFHSDQHOVSDFHWRDOORZIRUWKHLQVWDOODWLRQRIDGRXEOHSROHFLUFXLWEUHDNHUSHUPDQHQWO\ PDUNHGDV³)RU)XWXUH9XVH´ Electric Clothes Dryer Ready. Clothes dryer locations with gas or propane plumbing to serve individual dwelling units must include: A GHGLFDWHGXQREVWUXFWHG9EUDQFKFLUFXLWZLULQJLQVWDOOHGZLWKLQ¶RIWKHGU\HUORFDWLRQZLWKFLUFXLWFRQGXFWRUVUDWHGDWOHDVWDPSVZLWK WKHEODQNFRYHULGHQWLILHGDV³9UHDG\´DQGDUHVHUYHGPDLQHOHFWULFDOVHUYLFHSDQHOVSDFHWRDOORZIRUWKHLQVWDOODWLRQRIDGRXEOHSROH FLUFXLWEUHDNHUSHUPDQHQWO\PDUNHGDV³)RU)XWXUH9XVH´ *Exceptions may apply. ADU Conversion 1123 Magnolia Ave Santa Ana, Ca 92707 1123 S Magnolia Ave Unit# 22/19/2025 BUILDING ENERGY ANALYSIS REPORT PROJECT: Project Designer: Report Prepared by: Job Number: Date: The EnergyPro computer program has been used to perform the calculations summarized in this compliance report. This program has approval and is authorized by the California Energy Commission for use with both the Residential and Nonresidential 2022 Building Energy Efficiency Standards. This program developed by EnergySoft, LLC – www.energysoft.com. ADU Conversion 7755 Center Ave 5868 Agra St Bell Gardens , Ca 90201 Frank Solis Design Design 4 Building Robert Gonzales 562-685-1171 Santa Ana, Ca 92707 10/14/2024 24-968 Huntington Beach , Ca 92648 562-981-4890 1123 Magnolia Ave 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 1 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 GENERAL INFORMATION 01 Project Name 1123 Magnolia Ave ADU 02 Run Title Title 24 Analysis 03 Project Location 1123 Magnolia Ave 04 City Santa Ana 05 Standards Version 2022 06 Zip code 92707 07 Software Version EnergyPro 9.3 08 Climate Zone 8 09 Front Orientation (deg/ Cardinal)270 10 Building Type Single family 11 Number of Dwelling Units 1 12 Project Scope Newly Constructed Addition 13 Number of Bedrooms 5 14 Addition Cond. Floor Area (ft2)561 15 Number of Stories 1 16 Existing Cond. Floor Area (ft2)1346 17 Fenestration Average U-factor 0.3 18 Total Cond. Floor Area (ft2)1907 19 Glazing Percentage (%)7.49% 20 ADU Bedroom Count 1 21 ADU Conditioned Floor Area 561 22 Fuel Type Natural gas 23 No Dwelling Unit:No ADDITION ALONE - Project Analysis Parameters 01 02 03 04 05 06 Existing Area (excl. new addition) (ft2) Addition Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms 1346 561 1907 4 1 5 ADDITION ALONE - ACCESSORY DWELLING UNIT (ADU) PROJECT ANALYSIS PARAMETERS 01 02 03 04 05 06 07 08 Zone Name Existing Area (excl. new addition) (ft2) ADU Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms Attached vs. Detached Zone 1 1346 561 1907 4 1 5 Detached 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 2 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 COMPLIANCE RESULTS 01 Building Complies with Computer Performance 02 This building incorporates features that require field testing and/or verification by a certified HERS rater under the supervision of a CEC-approved HERS provider. 03 Building does not incorporate Special Features 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 3 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE SUMMARY Energy Use Standard Design Source Energy (EDR1) (kBtu/ft2 -yr) Standard Design TDV Energy (EDR2) (kTDV/ft2 -yr) Proposed Design Source Energy (EDR1) (kBtu/ft2 -yr) Proposed Design TDV Energy (EDR2) (kTDV/ft2 -yr) Compliance Margin (EDR1) Compliance Margin (EDR2) Space Heating 0 3.66 0 3.18 0 0.48 Space Cooling 0 35.29 0 39.71 0 -4.42 IAQ Ventilation 0 4.63 0 4.63 0 0 Water Heating 0 48.43 0 43.19 0 5.24 Self Utilization/Flexibility Credit 0 0 Efficiency Compliance Total 0 92.01 0 90.71 0 1.3 Photovoltaics 0 0 Battery 0 Flexibility Indoor Lighting 0 6.67 0 6.67 Appl. & Cooking 0 54.12 0 54.19 Plug Loads 0 65.54 0 65.54 Outdoor Lighting 0 5.57 0 5.57 TOTAL COMPLIANCE 0 223.91 0 222.68 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 4 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE INTENSITY Standard Design (kBtu/ft2 - yr )Proposed Design (kBtu/ft2 - yr )Compliance Margin (kBtu/ft2 - yr )Margin Percentage Gross EUI1 36.48 35.31 1.17 3.21 Net EUI2 36.48 35.31 1.17 3.21 Notes 1. Gross EUI is Energy Use Total (not including PV) / Total Building Area. 2. Net EUI is Energy Use Total (including PV) / Total Building Area. REQUIRED SPECIAL FEATURES The following are features that must be installed as condition for meeting the modeled energy performance for this computer analysis. •NO SPECIAL FEATURES REQUIRED HERS FEATURE SUMMARY The following is a summary of the features that must be field-verified by a certified HERS Rater as a condition for meeting the modeled energy performance for this computer analysis. Additional detail is provided in the building tables below. Registered CF2Rs and CF3Rs are required to be completed in the HERS Registry •Quality insulation installation (QII) •Indoor air quality ventilation •Kitchen range hood •Verified Refrigerant Charge •Verified heat pump rated heating capacity ZONE INFORMATION 01 02 03 04 05 06 07 Zone Name Zone Type HVAC System Name Zone Floor Area (ft2)Avg. Ceiling Height Water Heating System 1 Status Zone 1 Conditioned HVAC System1 561 8 DHW Sys 1 New 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 5 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 OPAQUE SURFACES 01 02 03 04 05 06 07 08 09 10 Name Zone Construction Azimuth Orientation Gross Area (ft2)Window and Door Area (ft2)Tilt (deg)Wall Exceptions Status Front Wall Zone 1 R-15 Wall 270 Front 144 33 90 Ex. w/ Siding New Left Wall Zone 1 R-15 Wall 0 Left 240 0 90 Ex. w/ Siding New Rear Wall Zone 1 R-15 Wall 90 Back 144 9 90 Ex. w/ Siding New Right Wall Zone 1 R-15 Wall 180 Right 240 21 90 Ex. w/ Siding New Roof Zone 1 R-30 Roof Attic n/a n/a 561 n/a n/a New ATTIC 01 02 03 04 05 06 07 08 Name Construction Type Roof Rise (x in 12)Roof Reflectance Roof Emittance Radiant Barrier Cool Roof Attic Zone 1 Attic RoofZone 1 Ventilated 4 0.1 0.85 No No FENESTRATION / GLAZING 01 02 03 04 05 06 07 08 09 10 11 12 13 14 Name Type Surface Orientation Azimuth Width (ft) Height (ft)Mult.Area (ft2)U-factor U-factor Source SHGC SHGC Source Exterior Shading Windows Window Front Wall Front 270 1 12 0.3 NFRC 0.23 NFRC Bug Screen Windows 2 Window Rear Wall Back 90 1 9 0.3 NFRC 0.23 NFRC Bug Screen Windows 3 Window Right Wall Right 180 1 21 0.3 NFRC 0.23 NFRC Bug Screen OPAQUE DOORS 01 02 03 04 Name Side of Building Area (ft2)U-factor Door Front Wall 21 0.5 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 6 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 SLAB FLOORS 01 02 03 04 05 06 07 08 Name Zone Area (ft2)Perimeter (ft)Edge Insul. R-value and Depth Edge Insul. R-value and Depth Carpeted Fraction Heated Slab Zone 1 561 96 none 0 80%No OPAQUE SURFACE CONSTRUCTIONS 01 02 03 04 05 06 07 08 Construction Name Surface Type Construction Type Framing Total Cavity R-value Interior / Exterior Continuous R-value U-factor Assembly Layers R-15 Wall Exterior Walls Wood Framed Wall 2x4 @ 16 in. O. C.R-15 None / None 0.095 Inside Finish: Gypsum Board Cavity / Frame: R-15 / 2x4 Exterior Finish: 3 Coat Stucco Attic RoofZone 1 Attic Roofs Wood Framed Ceiling 2x4 @ 24 in. O. C.R-0 None / 0 0.644 Roofing: Light Roof (Asphalt Shingle) Roof Deck: Wood Siding/sheathing/decking Cavity / Frame: no insul. / 2x4 R-30 Roof Attic Ceilings (below attic) Wood Framed Ceiling 2x4 @ 24 in. O. C.R-30 None / None 0.032 Over Ceiling Joists: R-20.9 insul. Cavity / Frame: R-9.1 / 2x4 Inside Finish: Gypsum Board BUILDING ENVELOPE - HERS VERIFICATION 01 02 03 04 05 Quality Insulation Installation (QII)High R-value Spray Foam Insulation Building Envelope Air Leakage CFM50 CFM50 Required Not Required N/A n/a n/a 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 7 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 WATER HEATING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Distribution Type Water Heater Name Number of Units Solar Heating System Compact Distribution HERS Verification Water Heater Name (#) DHW Sys 1 Domestic Hot Water (DHW)Standard DHW Heater 1 1 n/a None n/a DHW Heater 1 (1) WATER HEATERS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name Heating Element Type Tank Type # of Units Tank Vol. (gal) Heating Efficiency Type Efficiency Rated Input Type Input Rating or Pilot Tank Insulation R-value (Int/Ext) Standby Loss or Recovery Eff 1st Hr. Rating or Flow Rate Tank Location DHW Heater 1 Gas Consumer Instantaneo us 1 0 UEF 0.95 Btu/Hr 200000 0 n/a n/a WATER HEATING - HERS VERIFICATION 01 02 03 04 05 06 07 Name Pipe Insulation Parallel Piping Compact Distribution Compact Distribution Type Recirculation Control Shower Drain Water Heat Recovery DHW Sys 1 - 1/1 Not Required Not Required Not Required None Not Required Not Required SPACE CONDITIONING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Heating Unit Name Heating Equipment Count Cooling Unit Name Cooling Equipment Count Fan Name Distribution Name Required Thermostat Type HVAC System1 Heat pump heating cooling Heat Pump System 1 1 Heat Pump System 1 1 n/a n/a Setback 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 8 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 HVAC - HEAT PUMPS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name System Type Number of Units Heating Cooling Zonally Controlled Compressor Type HERS VerificationHeating Efficiency Type HSPF/HS PF2/COP Cap 47 Cap 17 Cooling Efficiency Type SEER/SE ER2 EER/EER 2/CEER Heat Pump System 1 Ductless MiniSplit HP 1 HSPF 9.5 18000 16000 EERSEER 17 12.5 Not Zonal Single Speed Heat Pump System 1-hers-htpump HVAC HEAT PUMPS - HERS VERIFICATION 01 02 03 04 05 06 07 08 09 Name Verified Airflow Airflow Target Verified EER/EER2 Verified SEER/SEER2 Verified Refrigerant Charge Verified HSPF/HSPF2 Verified Heating Cap 47 Verified Heating Cap 17 Heat Pump System 1-hers-htpump Not Required 0 Not Required Not Required Yes No Yes Yes INDOOR AIR QUALITY (IAQ) FANS 01 02 03 04 05 06 07 08 09 Dwelling Unit Airflow (CFM)Fan Efficacy (W/CFM)IAQ Fan Type Includes Heat/Energy Recovery? IAQ Recovery Effectiveness - SRE/ASRE Includes Fault Indicator Display?HERS Verification Status SFam ADU IAQVentRpt 32 0.35 Exhaust No n/a / n/a No Yes 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 9 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 DOCUMENTATION AUTHOR'S DECLARATION STATEMENT 1. I certify that this Certificate of Compliance documentation is accurate and complete. Documentation Author Name:Documentation Author Signature: Company:Signature Date: Address:CEA/ HERS Certification Identification (If applicable): City/State/Zip:Phone: RESPONSIBLE PERSON'S DECLARATION STATEMENT I certify the following under penalty of perjury, under the laws of the State of California: 1.I am eligible under Division 3 of the Business and Professions Code to accept responsibility for the building design identified on this Certificate of Compliance. 2.I certify that the energy features and performance specifications identified on this Certificate of Compliance conform to the requirements of Title 24, Part 1 and Part 6 of the California Code of Regulations. 3.The building design features or system design features identified on this Certificate of Compliance are consistent with the information provided on other applicable compliance documents, worksheets, calculations, plans and specifications submitted to the enforcement agency for approval with this building permit application. Responsible Designer Name:Responsible Designer Signature: Company:Date Signed: Address:License: City/State/Zip:Phone: Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. Digitally signed by California Home Energy Efficiency Rating Services (CHEERS). This digital signature is provided in order to secure the content of this registered document, and in no way implies Registration Provider responsibility for the accuracy of the information. 1123 S Magnolia Ave Unit# 22/19/2025 RESIDENTIAL MEASURES SUMMARY RMS-1 Project Name Building Type  Single Family  Addition Alone Date  Multi Family  Existing+ Addition/Alteration Project Address California Energy Climate Zone Total Cond. Floor Area Addition # of Units INSULATION Area Construction Type Cavity (ft2) Special Features Status FENESTRATION Total Area: Glazing Percentage: New/Altered Average U-Factor: Orientation Area(ft2) U-Fac SHGC Overhang Sidefins Exterior Shades Status HVAC SYSTEMS Qty. Heating Min. Eff Cooling Min. Eff Thermostat Status HVAC DISTRIBUTION Duct Location Heating Cooling Duct Location R-Value Status WATER HEATING Qty. Type Gallons Min. Eff Distribution Status New 561 Page 11 of 12 10/14/2024 none 7.5% New Perim = 96' ADU Conversion Wood Framed Attic Slab Unheated Slab-on-Grade none 561 42 n/a CA Climate Zone 08 R 15 9.0 Right (S)21.0 1 0.300 Small Instantaneous Gas 0.23 New 1 New 4 HVAC System Ductless / with Fan Wall Opaque Door Wall R 15 Wood Framed - no insulation - 561 R 15 Existing New 0.300 0.23 561 0 N/A 0.95 Existing New - no insulation - Ductless 17.0 SEER 21 New 111 Wall Wood Framed none none 1 none Electric Heat Pump Standard Rear (E) Front (W)12.0 n/a New 240 New Door Wall R 30 Wood Framed 1123 Magnolia Ave Santa Ana 219 N/A 9.50 HSPF 0.30 Split Heat Pump User Number: 20180 0.300 none 0.23 4 N/A Setback New New Roof ID: 24-968 R 15 Wood Framed EnergyPro 9.3 by EnergySoft 135 1123 S Magnolia Ave Unit# 22/19/2025 HVAC SYSTEM HEATING AND COOLING LOADS SUMMARY Project Name Date System Name Floor Area ENGINEERING CHECKS SYSTEM LOAD Number of Systems COIL COOLING PEAK COIL HTG. PEAK Heating System CFM Sensible Latent CFM Sensible Output per System Total Room Loads Total Output (Btuh) Return Vented Lighting Output (Btuh/sqft) Return Air Ducts Cooling System Return Fan Output per System Ventilation Total Output (Btuh) Supply Fan Total Output (Tons) Supply Air Ducts Total Output (Btuh/sqft) Total Output (sqft/Ton) TOTAL SYSTEM LOAD Air System CFM per System HVAC EQUIPMENT SELECTION Airflow (cfm) Airflow (cfm/sqft) Airflow (cfm/Ton) Outside Air (%) Total Adjusted System Output Outside Air (cfm/sqft) (Adjusted for Peak Design conditions) Note: values above given at ARI conditions TIME OF SYSTEM PEAK HEATING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Heating Peak) COOLING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Cooling Peak) 18,000 6,413 0 cfm 0 0 400.0 0 56 / 54 ºF55 / 54 ºF 10/14/2024 374.0 600 cfm 32.1 -921 Aug 3 PM 0 13,184 600 cfm 0.00 1.5 Mini Split Unit 56 / 54 ºF 0 75 / 61 ºF 0 0 204 106 ºF 921 Supply Fan 600 68 ºF 18,000 0 ADU Conversion 18,000 75 / 61 ºF 13,448 0 3,585 33 ºF 3,585 Heating Coil 600 106 ºF 177 1.5 HVAC System 561 0 7,334 Outside Air 13,448 4,986 4,065 68 ºF 0 272 13,184 Jan 1 AM 46.0% 1 1.07 Outside Air Cooling Coil 32.1 75 / 61 ºF 0 0 cfm 68 ºF 105 ºF 91 / 68 ºF Supply Fan 18,000 0.0% 272 1123 S Magnolia Ave Unit# 22/19/2025 BUILDING ENERGY ANALYSIS REPORT PROJECT: Project Designer: Report Prepared by: Job Number: Date: The EnergyPro computer program has been used to perform the calculations summarized in this compliance report. This program has approval and is authorized by the California Energy Commission for use with both the Residential and Nonresidential 2022 Building Energy Efficiency Standards. This program developed by EnergySoft, LLC – www.energysoft.com. ADU Conversion 7755 Center Ave 5868 Agra St Bell Gardens , Ca 90201 Frank Solis Design Design 4 Building Robert Gonzales 562-685-1171 Santa Ana, Ca 92707 10/14/2024 24-968 Huntington Beach , Ca 92648 562-981-4890 1123 Magnolia Ave 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 1 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 GENERAL INFORMATION 01 Project Name 1123 Magnolia Ave ADU 02 Run Title Title 24 Analysis 03 Project Location 1123 Magnolia Ave 04 City Santa Ana 05 Standards Version 2022 06 Zip code 92707 07 Software Version EnergyPro 9.3 08 Climate Zone 8 09 Front Orientation (deg/ Cardinal)270 10 Building Type Single family 11 Number of Dwelling Units 1 12 Project Scope Newly Constructed Addition 13 Number of Bedrooms 5 14 Addition Cond. Floor Area (ft2)561 15 Number of Stories 1 16 Existing Cond. Floor Area (ft2)1346 17 Fenestration Average U-factor 0.3 18 Total Cond. Floor Area (ft2)1907 19 Glazing Percentage (%)7.49% 20 ADU Bedroom Count 1 21 ADU Conditioned Floor Area 561 22 Fuel Type Natural gas 23 No Dwelling Unit:No ADDITION ALONE - Project Analysis Parameters 01 02 03 04 05 06 Existing Area (excl. new addition) (ft2) Addition Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms 1346 561 1907 4 1 5 ADDITION ALONE - ACCESSORY DWELLING UNIT (ADU) PROJECT ANALYSIS PARAMETERS 01 02 03 04 05 06 07 08 Zone Name Existing Area (excl. new addition) (ft2) ADU Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms Attached vs. Detached Zone 1 1346 561 1907 4 1 5 Detached 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 2 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 COMPLIANCE RESULTS 01 Building Complies with Computer Performance 02 This building incorporates features that require field testing and/or verification by a certified HERS rater under the supervision of a CEC-approved HERS provider. 03 Building does not incorporate Special Features 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 3 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE SUMMARY Energy Use Standard Design Source Energy (EDR1) (kBtu/ft2 -yr) Standard Design TDV Energy (EDR2) (kTDV/ft2 -yr) Proposed Design Source Energy (EDR1) (kBtu/ft2 -yr) Proposed Design TDV Energy (EDR2) (kTDV/ft2 -yr) Compliance Margin (EDR1) Compliance Margin (EDR2) Space Heating 0 3.66 0 3.18 0 0.48 Space Cooling 0 35.29 0 39.71 0 -4.42 IAQ Ventilation 0 4.63 0 4.63 0 0 Water Heating 0 48.43 0 43.19 0 5.24 Self Utilization/Flexibility Credit 0 0 Efficiency Compliance Total 0 92.01 0 90.71 0 1.3 Photovoltaics 0 0 Battery 0 Flexibility Indoor Lighting 0 6.67 0 6.67 Appl. & Cooking 0 54.12 0 54.19 Plug Loads 0 65.54 0 65.54 Outdoor Lighting 0 5.57 0 5.57 TOTAL COMPLIANCE 0 223.91 0 222.68 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 4 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE INTENSITY Standard Design (kBtu/ft2 - yr )Proposed Design (kBtu/ft2 - yr )Compliance Margin (kBtu/ft2 - yr )Margin Percentage Gross EUI1 36.48 35.31 1.17 3.21 Net EUI2 36.48 35.31 1.17 3.21 Notes 1. Gross EUI is Energy Use Total (not including PV) / Total Building Area. 2. Net EUI is Energy Use Total (including PV) / Total Building Area. REQUIRED SPECIAL FEATURES The following are features that must be installed as condition for meeting the modeled energy performance for this computer analysis. •NO SPECIAL FEATURES REQUIRED HERS FEATURE SUMMARY The following is a summary of the features that must be field-verified by a certified HERS Rater as a condition for meeting the modeled energy performance for this computer analysis. Additional detail is provided in the building tables below. Registered CF2Rs and CF3Rs are required to be completed in the HERS Registry •Quality insulation installation (QII) •Indoor air quality ventilation •Kitchen range hood •Verified Refrigerant Charge •Verified heat pump rated heating capacity ZONE INFORMATION 01 02 03 04 05 06 07 Zone Name Zone Type HVAC System Name Zone Floor Area (ft2)Avg. Ceiling Height Water Heating System 1 Status Zone 1 Conditioned HVAC System1 561 8 DHW Sys 1 New 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 5 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 OPAQUE SURFACES 01 02 03 04 05 06 07 08 09 10 Name Zone Construction Azimuth Orientation Gross Area (ft2)Window and Door Area (ft2)Tilt (deg)Wall Exceptions Status Front Wall Zone 1 R-15 Wall 270 Front 144 33 90 Ex. w/ Siding New Left Wall Zone 1 R-15 Wall 0 Left 240 0 90 Ex. w/ Siding New Rear Wall Zone 1 R-15 Wall 90 Back 144 9 90 Ex. w/ Siding New Right Wall Zone 1 R-15 Wall 180 Right 240 21 90 Ex. w/ Siding New Roof Zone 1 R-30 Roof Attic n/a n/a 561 n/a n/a New ATTIC 01 02 03 04 05 06 07 08 Name Construction Type Roof Rise (x in 12)Roof Reflectance Roof Emittance Radiant Barrier Cool Roof Attic Zone 1 Attic RoofZone 1 Ventilated 4 0.1 0.85 No No FENESTRATION / GLAZING 01 02 03 04 05 06 07 08 09 10 11 12 13 14 Name Type Surface Orientation Azimuth Width (ft) Height (ft)Mult.Area (ft2)U-factor U-factor Source SHGC SHGC Source Exterior Shading Windows Window Front Wall Front 270 1 12 0.3 NFRC 0.23 NFRC Bug Screen Windows 2 Window Rear Wall Back 90 1 9 0.3 NFRC 0.23 NFRC Bug Screen Windows 3 Window Right Wall Right 180 1 21 0.3 NFRC 0.23 NFRC Bug Screen OPAQUE DOORS 01 02 03 04 Name Side of Building Area (ft2)U-factor Door Front Wall 21 0.5 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 6 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 SLAB FLOORS 01 02 03 04 05 06 07 08 Name Zone Area (ft2)Perimeter (ft)Edge Insul. R-value and Depth Edge Insul. R-value and Depth Carpeted Fraction Heated Slab Zone 1 561 96 none 0 80%No OPAQUE SURFACE CONSTRUCTIONS 01 02 03 04 05 06 07 08 Construction Name Surface Type Construction Type Framing Total Cavity R-value Interior / Exterior Continuous R-value U-factor Assembly Layers R-15 Wall Exterior Walls Wood Framed Wall 2x4 @ 16 in. O. C.R-15 None / None 0.095 Inside Finish: Gypsum Board Cavity / Frame: R-15 / 2x4 Exterior Finish: 3 Coat Stucco Attic RoofZone 1 Attic Roofs Wood Framed Ceiling 2x4 @ 24 in. O. C.R-0 None / 0 0.644 Roofing: Light Roof (Asphalt Shingle) Roof Deck: Wood Siding/sheathing/decking Cavity / Frame: no insul. / 2x4 R-30 Roof Attic Ceilings (below attic) Wood Framed Ceiling 2x4 @ 24 in. O. C.R-30 None / None 0.032 Over Ceiling Joists: R-20.9 insul. Cavity / Frame: R-9.1 / 2x4 Inside Finish: Gypsum Board BUILDING ENVELOPE - HERS VERIFICATION 01 02 03 04 05 Quality Insulation Installation (QII)High R-value Spray Foam Insulation Building Envelope Air Leakage CFM50 CFM50 Required Not Required N/A n/a n/a 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 7 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 WATER HEATING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Distribution Type Water Heater Name Number of Units Solar Heating System Compact Distribution HERS Verification Water Heater Name (#) DHW Sys 1 Domestic Hot Water (DHW)Standard DHW Heater 1 1 n/a None n/a DHW Heater 1 (1) WATER HEATERS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name Heating Element Type Tank Type # of Units Tank Vol. (gal) Heating Efficiency Type Efficiency Rated Input Type Input Rating or Pilot Tank Insulation R-value (Int/Ext) Standby Loss or Recovery Eff 1st Hr. Rating or Flow Rate Tank Location DHW Heater 1 Gas Consumer Instantaneo us 1 0 UEF 0.95 Btu/Hr 200000 0 n/a n/a WATER HEATING - HERS VERIFICATION 01 02 03 04 05 06 07 Name Pipe Insulation Parallel Piping Compact Distribution Compact Distribution Type Recirculation Control Shower Drain Water Heat Recovery DHW Sys 1 - 1/1 Not Required Not Required Not Required None Not Required Not Required SPACE CONDITIONING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Heating Unit Name Heating Equipment Count Cooling Unit Name Cooling Equipment Count Fan Name Distribution Name Required Thermostat Type HVAC System1 Heat pump heating cooling Heat Pump System 1 1 Heat Pump System 1 1 n/a n/a Setback 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 8 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 HVAC - HEAT PUMPS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name System Type Number of Units Heating Cooling Zonally Controlled Compressor Type HERS VerificationHeating Efficiency Type HSPF/HS PF2/COP Cap 47 Cap 17 Cooling Efficiency Type SEER/SE ER2 EER/EER 2/CEER Heat Pump System 1 Ductless MiniSplit HP 1 HSPF 9.5 18000 16000 EERSEER 17 12.5 Not Zonal Single Speed Heat Pump System 1-hers-htpump HVAC HEAT PUMPS - HERS VERIFICATION 01 02 03 04 05 06 07 08 09 Name Verified Airflow Airflow Target Verified EER/EER2 Verified SEER/SEER2 Verified Refrigerant Charge Verified HSPF/HSPF2 Verified Heating Cap 47 Verified Heating Cap 17 Heat Pump System 1-hers-htpump Not Required 0 Not Required Not Required Yes No Yes Yes INDOOR AIR QUALITY (IAQ) FANS 01 02 03 04 05 06 07 08 09 Dwelling Unit Airflow (CFM)Fan Efficacy (W/CFM)IAQ Fan Type Includes Heat/Energy Recovery? IAQ Recovery Effectiveness - SRE/ASRE Includes Fault Indicator Display?HERS Verification Status SFam ADU IAQVentRpt 32 0.35 Exhaust No n/a / n/a No Yes 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 9 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 DOCUMENTATION AUTHOR'S DECLARATION STATEMENT 1. I certify that this Certificate of Compliance documentation is accurate and complete. Documentation Author Name:Documentation Author Signature: Company:Signature Date: Address:CEA/ HERS Certification Identification (If applicable): City/State/Zip:Phone: RESPONSIBLE PERSON'S DECLARATION STATEMENT I certify the following under penalty of perjury, under the laws of the State of California: 1.I am eligible under Division 3 of the Business and Professions Code to accept responsibility for the building design identified on this Certificate of Compliance. 2.I certify that the energy features and performance specifications identified on this Certificate of Compliance conform to the requirements of Title 24, Part 1 and Part 6 of the California Code of Regulations. 3.The building design features or system design features identified on this Certificate of Compliance are consistent with the information provided on other applicable compliance documents, worksheets, calculations, plans and specifications submitted to the enforcement agency for approval with this building permit application. Responsible Designer Name:Responsible Designer Signature: Company:Date Signed: Address:License: City/State/Zip:Phone: Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. Digitally signed by California Home Energy Efficiency Rating Services (CHEERS). This digital signature is provided in order to secure the content of this registered document, and in no way implies Registration Provider responsibility for the accuracy of the information. 1123 S Magnolia Ave Unit# 22/19/2025 RESIDENTIAL MEASURES SUMMARY RMS-1 Project Name Building Type  Single Family  Addition Alone Date  Multi Family  Existing+ Addition/Alteration Project Address California Energy Climate Zone Total Cond. Floor Area Addition # of Units INSULATION Area Construction Type Cavity (ft2) Special Features Status FENESTRATION Total Area: Glazing Percentage: New/Altered Average U-Factor: Orientation Area(ft2) U-Fac SHGC Overhang Sidefins Exterior Shades Status HVAC SYSTEMS Qty. Heating Min. Eff Cooling Min. Eff Thermostat Status HVAC DISTRIBUTION Duct Location Heating Cooling Duct Location R-Value Status WATER HEATING Qty. Type Gallons Min. Eff Distribution Status New 561 Page 11 of 12 10/14/2024 none 7.5% New Perim = 96' ADU Conversion Wood Framed Attic Slab Unheated Slab-on-Grade none 561 42 n/a CA Climate Zone 08 R 15 9.0 Right (S)21.0 1 0.300 Small Instantaneous Gas 0.23 New 1 New 4 HVAC System Ductless / with Fan Wall Opaque Door Wall R 15 Wood Framed - no insulation - 561 R 15 Existing New 0.300 0.23 561 0 N/A 0.95 Existing New - no insulation - Ductless 17.0 SEER 21 New 111 Wall Wood Framed none none 1 none Electric Heat Pump Standard Rear (E) Front (W)12.0 n/a New 240 New Door Wall R 30 Wood Framed 1123 Magnolia Ave Santa Ana 219 N/A 9.50 HSPF 0.30 Split Heat Pump User Number: 20180 0.300 none 0.23 4 N/A Setback New New Roof ID: 24-968 R 15 Wood Framed EnergyPro 9.3 by EnergySoft 135 1123 S Magnolia Ave Unit# 22/19/2025 HVAC SYSTEM HEATING AND COOLING LOADS SUMMARY Project Name Date System Name Floor Area ENGINEERING CHECKS SYSTEM LOAD Number of Systems COIL COOLING PEAK COIL HTG. PEAK Heating System CFM Sensible Latent CFM Sensible Output per System Total Room Loads Total Output (Btuh) Return Vented Lighting Output (Btuh/sqft) Return Air Ducts Cooling System Return Fan Output per System Ventilation Total Output (Btuh) Supply Fan Total Output (Tons) Supply Air Ducts Total Output (Btuh/sqft) Total Output (sqft/Ton) TOTAL SYSTEM LOAD Air System CFM per System HVAC EQUIPMENT SELECTION Airflow (cfm) Airflow (cfm/sqft) Airflow (cfm/Ton) Outside Air (%) Total Adjusted System Output Outside Air (cfm/sqft) (Adjusted for Peak Design conditions) Note: values above given at ARI conditions TIME OF SYSTEM PEAK HEATING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Heating Peak) COOLING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Cooling Peak) 18,000 6,413 0 cfm 0 0 400.0 0 56 / 54 ºF55 / 54 ºF 10/14/2024 374.0 600 cfm 32.1 -921 Aug 3 PM 0 13,184 600 cfm 0.00 1.5 Mini Split Unit 56 / 54 ºF 0 75 / 61 ºF 0 0 204 106 ºF 921 Supply Fan 600 68 ºF 18,000 0 ADU Conversion 18,000 75 / 61 ºF 13,448 0 3,585 33 ºF 3,585 Heating Coil 600 106 ºF 177 1.5 HVAC System 561 0 7,334 Outside Air 13,448 4,986 4,065 68 ºF 0 272 13,184 Jan 1 AM 46.0% 1 1.07 Outside Air Cooling Coil 32.1 75 / 61 ºF 0 0 cfm 68 ºF 105 ºF 91 / 68 ºF Supply Fan 18,000 0.0% 272 1123 S Magnolia Ave Unit# 22/19/2025 LCMAGNOLIA PL PLPL PL (E)GRASS (E)CONCRETE PATIO (E)MAIN STRUCTURE 1364 SQFT (E)DRIVE WAY (E)FRONT YARD (E) STORAGE SHED 90 SQFT WH 24 3 F T 23 8 F T DOWN STREAM MANHOLE WM-1 WM-5 WM-8 1% F L 1% F L 2% F L 2% F L SC-5 AD U 11 2 3 M A G N O L I A A V E U N I T # 2 , SA N T A A N , C A , 9 2 7 0 7 This drawings,specifications and ideas, with these drawings shall constitute evidence EROSION CONTROL PLAN SHEET TITLE REVISIONS designs thereby are and shall remain the property of F. SOLIS (Designer) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F.SOLIS,visual contact of acceptance of these restrictions. A-1 1 PLAN CHECK 10.08.24 2 PLAN CHECK 11.18.24 DR A W I N G S P R E P A R E D B Y : FR A N K S O L I S 58 6 8 A G R A S T BE L L G A R D E N S , C A 9 0 2 0 1 1123 S Magnolia Ave Unit# 22/19/2025 BUILDING ENERGY ANALYSIS REPORT PROJECT: Project Designer: Report Prepared by: Job Number: Date: The EnergyPro computer program has been used to perform the calculations summarized in this compliance report. This program has approval and is authorized by the California Energy Commission for use with both the Residential and Nonresidential 2022 Building Energy Efficiency Standards. This program developed by EnergySoft, LLC – www.energysoft.com. ADU Conversion 7755 Center Ave 5868 Agra St Bell Gardens , Ca 90201 Frank Solis Design Design 4 Building Robert Gonzales 562-685-1171 Santa Ana, Ca 92707 10/14/2024 24-968 Huntington Beach , Ca 92648 562-981-4890 1123 Magnolia Ave 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 1 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 GENERAL INFORMATION 01 Project Name 1123 Magnolia Ave ADU 02 Run Title Title 24 Analysis 03 Project Location 1123 Magnolia Ave 04 City Santa Ana 05 Standards Version 2022 06 Zip code 92707 07 Software Version EnergyPro 9.3 08 Climate Zone 8 09 Front Orientation (deg/ Cardinal)270 10 Building Type Single family 11 Number of Dwelling Units 1 12 Project Scope Newly Constructed Addition 13 Number of Bedrooms 5 14 Addition Cond. Floor Area (ft2)561 15 Number of Stories 1 16 Existing Cond. Floor Area (ft2)1346 17 Fenestration Average U-factor 0.3 18 Total Cond. Floor Area (ft2)1907 19 Glazing Percentage (%)7.49% 20 ADU Bedroom Count 1 21 ADU Conditioned Floor Area 561 22 Fuel Type Natural gas 23 No Dwelling Unit:No ADDITION ALONE - Project Analysis Parameters 01 02 03 04 05 06 Existing Area (excl. new addition) (ft2) Addition Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms 1346 561 1907 4 1 5 ADDITION ALONE - ACCESSORY DWELLING UNIT (ADU) PROJECT ANALYSIS PARAMETERS 01 02 03 04 05 06 07 08 Zone Name Existing Area (excl. new addition) (ft2) ADU Area (excl. existing) (ft2)Total Area (ft2)Existing Bedrooms Addition Bedrooms Total Bedrooms Attached vs. Detached Zone 1 1346 561 1907 4 1 5 Detached 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 2 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 COMPLIANCE RESULTS 01 Building Complies with Computer Performance 02 This building incorporates features that require field testing and/or verification by a certified HERS rater under the supervision of a CEC-approved HERS provider. 03 Building does not incorporate Special Features 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 3 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE SUMMARY Energy Use Standard Design Source Energy (EDR1) (kBtu/ft2 -yr) Standard Design TDV Energy (EDR2) (kTDV/ft2 -yr) Proposed Design Source Energy (EDR1) (kBtu/ft2 -yr) Proposed Design TDV Energy (EDR2) (kTDV/ft2 -yr) Compliance Margin (EDR1) Compliance Margin (EDR2) Space Heating 0 3.66 0 3.18 0 0.48 Space Cooling 0 35.29 0 39.71 0 -4.42 IAQ Ventilation 0 4.63 0 4.63 0 0 Water Heating 0 48.43 0 43.19 0 5.24 Self Utilization/Flexibility Credit 0 0 Efficiency Compliance Total 0 92.01 0 90.71 0 1.3 Photovoltaics 0 0 Battery 0 Flexibility Indoor Lighting 0 6.67 0 6.67 Appl. & Cooking 0 54.12 0 54.19 Plug Loads 0 65.54 0 65.54 Outdoor Lighting 0 5.57 0 5.57 TOTAL COMPLIANCE 0 223.91 0 222.68 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 4 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 ENERGY USE INTENSITY Standard Design (kBtu/ft2 - yr )Proposed Design (kBtu/ft2 - yr )Compliance Margin (kBtu/ft2 - yr )Margin Percentage Gross EUI1 36.48 35.31 1.17 3.21 Net EUI2 36.48 35.31 1.17 3.21 Notes 1. Gross EUI is Energy Use Total (not including PV) / Total Building Area. 2. Net EUI is Energy Use Total (including PV) / Total Building Area. REQUIRED SPECIAL FEATURES The following are features that must be installed as condition for meeting the modeled energy performance for this computer analysis. •NO SPECIAL FEATURES REQUIRED HERS FEATURE SUMMARY The following is a summary of the features that must be field-verified by a certified HERS Rater as a condition for meeting the modeled energy performance for this computer analysis. Additional detail is provided in the building tables below. Registered CF2Rs and CF3Rs are required to be completed in the HERS Registry •Quality insulation installation (QII) •Indoor air quality ventilation •Kitchen range hood •Verified Refrigerant Charge •Verified heat pump rated heating capacity ZONE INFORMATION 01 02 03 04 05 06 07 Zone Name Zone Type HVAC System Name Zone Floor Area (ft2)Avg. Ceiling Height Water Heating System 1 Status Zone 1 Conditioned HVAC System1 561 8 DHW Sys 1 New 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 5 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 OPAQUE SURFACES 01 02 03 04 05 06 07 08 09 10 Name Zone Construction Azimuth Orientation Gross Area (ft2)Window and Door Area (ft2)Tilt (deg)Wall Exceptions Status Front Wall Zone 1 R-15 Wall 270 Front 144 33 90 Ex. w/ Siding New Left Wall Zone 1 R-15 Wall 0 Left 240 0 90 Ex. w/ Siding New Rear Wall Zone 1 R-15 Wall 90 Back 144 9 90 Ex. w/ Siding New Right Wall Zone 1 R-15 Wall 180 Right 240 21 90 Ex. w/ Siding New Roof Zone 1 R-30 Roof Attic n/a n/a 561 n/a n/a New ATTIC 01 02 03 04 05 06 07 08 Name Construction Type Roof Rise (x in 12)Roof Reflectance Roof Emittance Radiant Barrier Cool Roof Attic Zone 1 Attic RoofZone 1 Ventilated 4 0.1 0.85 No No FENESTRATION / GLAZING 01 02 03 04 05 06 07 08 09 10 11 12 13 14 Name Type Surface Orientation Azimuth Width (ft) Height (ft)Mult.Area (ft2)U-factor U-factor Source SHGC SHGC Source Exterior Shading Windows Window Front Wall Front 270 1 12 0.3 NFRC 0.23 NFRC Bug Screen Windows 2 Window Rear Wall Back 90 1 9 0.3 NFRC 0.23 NFRC Bug Screen Windows 3 Window Right Wall Right 180 1 21 0.3 NFRC 0.23 NFRC Bug Screen OPAQUE DOORS 01 02 03 04 Name Side of Building Area (ft2)U-factor Door Front Wall 21 0.5 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 6 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 SLAB FLOORS 01 02 03 04 05 06 07 08 Name Zone Area (ft2)Perimeter (ft)Edge Insul. R-value and Depth Edge Insul. R-value and Depth Carpeted Fraction Heated Slab Zone 1 561 96 none 0 80%No OPAQUE SURFACE CONSTRUCTIONS 01 02 03 04 05 06 07 08 Construction Name Surface Type Construction Type Framing Total Cavity R-value Interior / Exterior Continuous R-value U-factor Assembly Layers R-15 Wall Exterior Walls Wood Framed Wall 2x4 @ 16 in. O. C.R-15 None / None 0.095 Inside Finish: Gypsum Board Cavity / Frame: R-15 / 2x4 Exterior Finish: 3 Coat Stucco Attic RoofZone 1 Attic Roofs Wood Framed Ceiling 2x4 @ 24 in. O. C.R-0 None / 0 0.644 Roofing: Light Roof (Asphalt Shingle) Roof Deck: Wood Siding/sheathing/decking Cavity / Frame: no insul. / 2x4 R-30 Roof Attic Ceilings (below attic) Wood Framed Ceiling 2x4 @ 24 in. O. C.R-30 None / None 0.032 Over Ceiling Joists: R-20.9 insul. Cavity / Frame: R-9.1 / 2x4 Inside Finish: Gypsum Board BUILDING ENVELOPE - HERS VERIFICATION 01 02 03 04 05 Quality Insulation Installation (QII)High R-value Spray Foam Insulation Building Envelope Air Leakage CFM50 CFM50 Required Not Required N/A n/a n/a 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 7 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 WATER HEATING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Distribution Type Water Heater Name Number of Units Solar Heating System Compact Distribution HERS Verification Water Heater Name (#) DHW Sys 1 Domestic Hot Water (DHW)Standard DHW Heater 1 1 n/a None n/a DHW Heater 1 (1) WATER HEATERS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name Heating Element Type Tank Type # of Units Tank Vol. (gal) Heating Efficiency Type Efficiency Rated Input Type Input Rating or Pilot Tank Insulation R-value (Int/Ext) Standby Loss or Recovery Eff 1st Hr. Rating or Flow Rate Tank Location DHW Heater 1 Gas Consumer Instantaneo us 1 0 UEF 0.95 Btu/Hr 200000 0 n/a n/a WATER HEATING - HERS VERIFICATION 01 02 03 04 05 06 07 Name Pipe Insulation Parallel Piping Compact Distribution Compact Distribution Type Recirculation Control Shower Drain Water Heat Recovery DHW Sys 1 - 1/1 Not Required Not Required Not Required None Not Required Not Required SPACE CONDITIONING SYSTEMS 01 02 03 04 05 06 07 08 09 Name System Type Heating Unit Name Heating Equipment Count Cooling Unit Name Cooling Equipment Count Fan Name Distribution Name Required Thermostat Type HVAC System1 Heat pump heating cooling Heat Pump System 1 1 Heat Pump System 1 1 n/a n/a Setback 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 8 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 HVAC - HEAT PUMPS 01 02 03 04 05 06 07 08 09 10 11 12 13 Name System Type Number of Units Heating Cooling Zonally Controlled Compressor Type HERS VerificationHeating Efficiency Type HSPF/HS PF2/COP Cap 47 Cap 17 Cooling Efficiency Type SEER/SE ER2 EER/EER 2/CEER Heat Pump System 1 Ductless MiniSplit HP 1 HSPF 9.5 18000 16000 EERSEER 17 12.5 Not Zonal Single Speed Heat Pump System 1-hers-htpump HVAC HEAT PUMPS - HERS VERIFICATION 01 02 03 04 05 06 07 08 09 Name Verified Airflow Airflow Target Verified EER/EER2 Verified SEER/SEER2 Verified Refrigerant Charge Verified HSPF/HSPF2 Verified Heating Cap 47 Verified Heating Cap 17 Heat Pump System 1-hers-htpump Not Required 0 Not Required Not Required Yes No Yes Yes INDOOR AIR QUALITY (IAQ) FANS 01 02 03 04 05 06 07 08 09 Dwelling Unit Airflow (CFM)Fan Efficacy (W/CFM)IAQ Fan Type Includes Heat/Energy Recovery? IAQ Recovery Effectiveness - SRE/ASRE Includes Fault Indicator Display?HERS Verification Status SFam ADU IAQVentRpt 32 0.35 Exhaust No n/a / n/a No Yes 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. 1123 S Magnolia Ave Unit# 22/19/2025 CERTIFICATE OF COMPLIANCE - RESIDENTIAL PERFORMANCE COMPLIANCE METHOD CF1R-PRF-01-E Project Name:1123 Magnolia Ave ADU Calculation Date/Time:2024-10-14T08:30:53-07:00 (Page 9 of 9) Calculation Description:Title 24 Analysis Input File Name:24-968.ribd22x Registration Number:Registration Date/Time: HERS Provider: CA Building Energy Efficiency Standards - 2022 Residential Compliance Report Version: 2022.0.000 Schema Version: rev 20220901 Report Generated: 2024-10-14 08:31:14 DOCUMENTATION AUTHOR'S DECLARATION STATEMENT 1. I certify that this Certificate of Compliance documentation is accurate and complete. Documentation Author Name:Documentation Author Signature: Company:Signature Date: Address:CEA/ HERS Certification Identification (If applicable): City/State/Zip:Phone: RESPONSIBLE PERSON'S DECLARATION STATEMENT I certify the following under penalty of perjury, under the laws of the State of California: 1.I am eligible under Division 3 of the Business and Professions Code to accept responsibility for the building design identified on this Certificate of Compliance. 2.I certify that the energy features and performance specifications identified on this Certificate of Compliance conform to the requirements of Title 24, Part 1 and Part 6 of the California Code of Regulations. 3.The building design features or system design features identified on this Certificate of Compliance are consistent with the information provided on other applicable compliance documents, worksheets, calculations, plans and specifications submitted to the enforcement agency for approval with this building permit application. Responsible Designer Name:Responsible Designer Signature: Company:Date Signed: Address:License: City/State/Zip:Phone: Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 Robert Gonzales Design 4 Building 10/14/2024 7755 Center Ave. Suite 1100 Huntington Beach , CA 92648 562-981-4890 424-P010246642A-000-000-0000000-0000 10/14/2024 08:34 CHEERS NOTICE: This document has been generated by California Home Energy Efficiency Rating Services (CHEERS) using information uploaded by third parties not affiliated with or related to CHEERS. Therefore, CHEERS is not responsible for, and cannot guarantee, the accuracy or completeness of the information contained in this document. Digitally signed by California Home Energy Efficiency Rating Services (CHEERS). This digital signature is provided in order to secure the content of this registered document, and in no way implies Registration Provider responsibility for the accuracy of the information. 1123 S Magnolia Ave Unit# 22/19/2025 RESIDENTIAL MEASURES SUMMARY RMS-1 Project Name Building Type  Single Family  Addition Alone Date  Multi Family  Existing+ Addition/Alteration Project Address California Energy Climate Zone Total Cond. Floor Area Addition # of Units INSULATION Area Construction Type Cavity (ft2) Special Features Status FENESTRATION Total Area: Glazing Percentage: New/Altered Average U-Factor: Orientation Area(ft2) U-Fac SHGC Overhang Sidefins Exterior Shades Status HVAC SYSTEMS Qty. Heating Min. Eff Cooling Min. Eff Thermostat Status HVAC DISTRIBUTION Duct Location Heating Cooling Duct Location R-Value Status WATER HEATING Qty. Type Gallons Min. Eff Distribution Status New 561 Page 11 of 12 10/14/2024 none 7.5% New Perim = 96' ADU Conversion Wood Framed Attic Slab Unheated Slab-on-Grade none 561 42 n/a CA Climate Zone 08 R 15 9.0 Right (S)21.0 1 0.300 Small Instantaneous Gas 0.23 New 1 New 4 HVAC System Ductless / with Fan Wall Opaque Door Wall R 15 Wood Framed - no insulation - 561 R 15 Existing New 0.300 0.23 561 0 N/A 0.95 Existing New - no insulation - Ductless 17.0 SEER 21 New 111 Wall Wood Framed none none 1 none Electric Heat Pump Standard Rear (E) Front (W)12.0 n/a New 240 New Door Wall R 30 Wood Framed 1123 Magnolia Ave Santa Ana 219 N/A 9.50 HSPF 0.30 Split Heat Pump User Number: 20180 0.300 none 0.23 4 N/A Setback New New Roof ID: 24-968 R 15 Wood Framed EnergyPro 9.3 by EnergySoft 135 1123 S Magnolia Ave Unit# 22/19/2025 HVAC SYSTEM HEATING AND COOLING LOADS SUMMARY Project Name Date System Name Floor Area ENGINEERING CHECKS SYSTEM LOAD Number of Systems COIL COOLING PEAK COIL HTG. PEAK Heating System CFM Sensible Latent CFM Sensible Output per System Total Room Loads Total Output (Btuh) Return Vented Lighting Output (Btuh/sqft) Return Air Ducts Cooling System Return Fan Output per System Ventilation Total Output (Btuh) Supply Fan Total Output (Tons) Supply Air Ducts Total Output (Btuh/sqft) Total Output (sqft/Ton) TOTAL SYSTEM LOAD Air System CFM per System HVAC EQUIPMENT SELECTION Airflow (cfm) Airflow (cfm/sqft) Airflow (cfm/Ton) Outside Air (%) Total Adjusted System Output Outside Air (cfm/sqft) (Adjusted for Peak Design conditions) Note: values above given at ARI conditions TIME OF SYSTEM PEAK HEATING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Heating Peak) COOLING SYSTEM PSYCHROMETRICS (Airstream Temperatures at Time of Cooling Peak) 18,000 6,413 0 cfm 0 0 400.0 0 56 / 54 ºF55 / 54 ºF 10/14/2024 374.0 600 cfm 32.1 -921 Aug 3 PM 0 13,184 600 cfm 0.00 1.5 Mini Split Unit 56 / 54 ºF 0 75 / 61 ºF 0 0 204 106 ºF 921 Supply Fan 600 68 ºF 18,000 0 ADU Conversion 18,000 75 / 61 ºF 13,448 0 3,585 33 ºF 3,585 Heating Coil 600 106 ºF 177 1.5 HVAC System 561 0 7,334 Outside Air 13,448 4,986 4,065 68 ºF 0 272 13,184 Jan 1 AM 46.0% 1 1.07 Outside Air Cooling Coil 32.1 75 / 61 ºF 0 0 cfm 68 ºF 105 ºF 91 / 68 ºF Supply Fan 18,000 0.0% 272 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)149 @ 2' 11 1/4"2231 (3.50")Passed (7%)--1.0 D + 1.0 Lr (All Spans) Shear (lbs)94 @ 3' 4 1/2"788 Passed (12%)1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)-130 @ 2' 11 1/4"431 Passed (30%)1.25 1.0 D + 1.0 Lr (All Spans) Live Load Defl. (in)0.030 @ 4' 4"0.200 Passed (2L/999+)--1.0 D + 1.0 Lr (Alt Spans) Total Load Defl. (in)0.050 @ 4' 4"0.200 Passed (2L/674)--1.0 D + 1.0 Lr (Alt Spans) Member Length : 4' 4" System : Roof Member Type : Flush Beam Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD Member Pitch : 0/12 •Deflection criteria: LL (L/240) and TL (L/180). •Overhang deflection criteria: LL (0.2") and TL (0.2"). •Allowed moment does not reflect the adjustment for the beam stability factor. •Applicable calculations are based on NDS. • Blocking Panels are assumed to carry no loads applied directly above them and the full load is applied to the member being designed. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Column Cap - steel 3.50"3.50"1.50"-15 -27 -42 Blocking 2 - Stud wall - SPF 3.50"3.50"1.50"61 88 149 Blocking •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)4' 4" o/c Bottom Edge (Lu)4' 4" o/c • Side loads are assumed to not induce cross-grain tension. Dead Roof Live Vertical Loads Location (Side)Tributary Width (0.90)(1.25)Comments 0 - Self Weight (PLF)0 to 4' 4"N/A 1.3 -- 1 - Uniform (PSF)0 to 4' 4" (Front)0 15.0 20.0 Default Load 2 - Point (lb)4' 4" (Front)N/A 35 55 Member Notes (converted from: Roof Drop Beam) Weyerhaeuser warrants that the sizing of its products will be in accordance with Weyerhaeuser product design criteria and published design values. Weyerhaeuser expressly disclaims any other warranties related to the software. Use of this software is not intended to circumvent the need for a design professional as determined by the authority having jurisdiction. The designer of record, builder or framer is responsible to assure that this calculation is compatible with the overall project. Accessories (Rim Board, Blocking Panels and Squash Blocks) are not designed by this software. Products manufactured at Weyerhaeuser facilities are third-party certified to sustainable forestry standards. Weyerhaeuser Engineered Lumber Products have been evaluated by ICC-ES under evaluation reports ESR-1153 and ESR-1387 and/or tested in accordance with applicable ASTM standards. For current code evaluation reports, Weyerhaeuser product literature and installation details refer to www.weyerhaeuser.com/woodproducts/ document-library. The product application, input design loads, dimensions and support information have been provided by ForteWEB Software Operator Weyerhaeuser Notes Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Roof: Rim Joist B6 1 piece(s) 2 x 4 DF No.2 ForteWEB Software Operator Job Notes 1/2/2025 6:42:14 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 1 / 1 1123 S Magnolia Ave Unit# 22/19/2025 STRUCTURAL CALCULATIONS FOR PLAN CHECK RESPONSE ADU Garage Conversion & Addition 1123 Magnolia Ave, Santa Ana, CA 92707 Prepared For Vision ADU, LLC 405 S Mission Dr., San Gabriel, CA 91776 by BRYSON CONSULTING STRUCTURAL ENGINEERS 5318 E. 2nd St, #679 Long Beach, CA 90803 Job No. 16113.00 September 30, 2024 No. 4979 1123 S Magnolia Ave Unit# 22/19/2025 Table Of Contents Table Of Contents & Design Notes..…………………………………………..………………………………………. Page 1 Gravity, Wind, & Seismic Loading Criteria………..…………………….………………………………………….. Page 2 Wood Floor & Roof Framing.……………………….……………………………………………………………………… Page 5 Wood Shearwall Design .……………………….…….…….………………………….………………………………….. Page 13 Concrete Anchorage Design…..……………………………….……..………………………………………………….. Page 44 Concrete Foundation Design .…………………..………….……………………….………………………………….. Page 54 Design Notes Project is for a one-storey ADU residence that will convert an existing 400 sq. ft. garage space and add an additional 150 sq. ft. and a new covered porch. Construction will be wood framing and plywood shearwalls supported on a concrete slab on grade foundation. No. 4979 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 1 1123 S Magnolia Ave Unit# 22/19/2025 Dead & Live Load Criteria Residential Wood Roof Loads Dead Load Gravity Seismic roofing 1.0 psf 1.0 psf asphalt shingles 2.5 psf 2.5 psf insulation 1.0 psf 1.0 psf 1/2" plywood sheathing 1.5 psf 1.5 psf SUB-TOTAL 6.0 psf 6.0 psf misc mech + plumbing 2.0 psf 2.0 psf 2x6 roof rafters @ 24" O.C.0.6 psf 0.6 psf SUB-TOTAL 8.6 psf 8.6 psf 2x8 ceiling joists @ 24" O.C.1.3 psf 1.3 psf 1/2" gypboard ceiling 2.8 psf 2.8 psf 4x8 wood beams @ 15'-0" O.C.0.4 psf 0.4 psf SUB-TOTAL 13.1 psf 13.1 psf wood columns 0.1 psf 0.0 psf SUB-TOTAL 13.2 psf 13.1 psf interior wall partitions 6.0 psf 3.0 psf exterior walls 8.8 psf 4.4 psf TOTAL DEAD LOAD 28.0 psf 20.6 psf Live Load TYPICAL ROOF LIVE LOAD 20 psf (reducible) Walls Interior Wood Partition Walls Gravity Seismic 5/8" drywall ea. side 5.6 psf 2x4 @16" O.C. wall studs 0.9 psf double top plate + sole plate 0.5 psf misc. MEP 0.5 psf SUB-TOTAL 7.5 psf 7.5 psf avg. height 8 ft avg. spacing 10 ft TOTAL 6.0 psf 6.0 psf Exterior Wood Shear Walls Gravity Seismic 2x4 @16" O.C. wall studs 0.9 psf double top plate + sole plate + rim joist 0.7 psf 1/2" plywood sheathing one side 1.5 psf 5/8" drywall one side 2.8 psf 1" stucco siding exterior 8.0 psf Misc. MEP 0.5 psf SUB-TOTAL 14.5 psf 14.5 psf avg. height 9.15 ft avg. spacing 15.00 ft TOTAL 8.8 psf 8.8 psf Page 1 of 1 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 2 1123 S Magnolia Ave Unit# 22/19/2025 ASCE Hazards Report Address: 1123 Magnolia Ave Santa Ana, California 92707 Standard:ASCE/SEI 7-22 Latitude:33.733632 Risk Category:II Longitude:-117.883752 Soil Class:Default Elevation:73.45061524740123 ft (NAVD 88) Wind Results: Wind Speed 95 Vmph 10-year MRI 66 Vmph 25-year MRI 72 Vmph 50-year MRI 76 Vmph 100-year MRI 81 Vmph 300-year MRI 89 Vmph 700-year MRI 95 Vmph 1,700-year MRI 102 Vmph 3,000-year MRI 106 Vmph 10,000-year MRI 115 Vmph 100,000-year MRI 133 Vmph 1,000,000-year MRI 151 Vmph Data Source: ASCE/SEI 7-22, Fig. 26.5-1B and Figs. CC.2-1–CC.2-4, and Section 26.5.2 Date Accessed: Mon Sep 23 2024 Page 1 of 5https://ascehazardtool.org/Mon Sep 23 2024 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 3 1123 S Magnolia Ave Unit# 22/19/2025 PGA M : 0.66 SMS : 1.74 SM1 : 1.21 SDS : 1.16 SD1 : 0.81 T L : 8 SS : 1.48 S1 : 0.53 VS30 : 260 Seismic Design Category:D Multi-Period Design Spectrum S (g) vs T(s)a Multi-Period MCE SpectrumR S (g) vs T(s)a Two-Period Design Spectrum S (g) vs T(s)a Two-Period MCE SpectrumR S (g) vs T(s)a Design Vertical Response Spectrum Vertical ground motion data has not yet been made available by USGS. MCE Vertical Response SpectrumR Vertical ground motion data has not yet been made available by USGS. Seismic DefaultSite Soil Class: Results: Page 3 of 5https://ascehazardtool.org/Mon Sep 23 2024 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 4 1123 S Magnolia Ave Unit# 22/19/2025 Roof Level Member Name Results (Max UTIL %)Current Solution Comments Roof: Joist J1 Passed (53% M)1 piece(s) 2 x 4 DF No.2 @ 24" OC Roof: Joist J2 Passed (60% M)1 piece(s) 2 x 6 DF No.2 @ 24" OC Roof: Ceiling Joist J3 Passed (73% ΔT)1 piece(s) 2 x 8 DF No.2 @ 24" OC Wall: Header B1 Passed (98% ΔT)1 piece(s) 2 x 4 DF No.2 (Plank) Wall: Header B2 Passed (35% B/C)1 piece(s) 4 x 6 DF No.2 Wall: Header B3 Passed (30% B/C)1 piece(s) 4 x 6 DF No.2 Roof: Drop Beam B4 Passed (52% M)1 piece(s) 4 x 4 DF No.2 16113.00.ADU 1123 Magnolia Ave JOB SUMMARY REPORT ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8 File Name: 16113.00.ADU 1123 Magnolia Ave Page 1 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 5 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)199 @ 2 1/2" 2231 (3.50") Passed (9%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)162 @ 6 13/16"788 Passed (21%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)262 @ 3' 1/2"495 Passed (53%) 1.25 1.0 D + 1.0 Lr (All Spans) Live Load Defl. (in)0.120 @ 3' 1/2" 0.299 Passed (L/596) -- 1.0 D + 1.0 Lr (All Spans) Total Load Defl. (in)0.196 @ 3' 1/2" 0.398 Passed (L/365) -- 1.0 D + 1.0 Lr (All Spans) Member Length : 6' 6 1/8" System : Roof Member Type : Joist Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD Member Pitch : 4/12 • Deflection criteria: LL (L/240) and TL (L/180). • Allowed moment does not reflect the adjustment for the beam stability factor. • A 15% increase in the moment capacity has been added to account for repetitive member usage. • Applicable calculations are based on NDS. • Blocking Panels are assumed to carry no loads applied directly above them and the full load is applied to the member being designed. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Beveled Plate - SPF 3.50" 3.50" 1.50" 77 122 199 Blocking 2 - Beveled Plate - SPF 3.50" 3.50" 1.50" 77 122 199 Blocking •Maximum allowable bracing intervals based on applied load. •Dimensions for lateral bracing intervals are measured along the length of the member for sloped conditions. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)6' 5" o/c Bottom Edge (Lu)6' 5" o/c Dead Roof Live Vertical Load Location (Side)Spacing (0.90)(1.25)Comments 1 - Uniform (PSF)0 to 6' 1"24"12.0 20.0 Default Load Weyerhaeuser warrants that the sizing of its products will be in accordance with Weyerhaeuser product design criteria and published design values. Weyerhaeuser expressly disclaims any other warranties related to the software. Use of this software is not intended to circumvent the need for a design professional as determined by the authority having jurisdiction. The designer of record, builder or framer is responsible to assure that this calculation is compatible with the overall project. Accessories (Rim Board, Blocking Panels and Squash Blocks) are not designed by this software. Products manufactured at Weyerhaeuser facilities are third-party certified to sustainable forestry standards. Weyerhaeuser Engineered Lumber Products have been evaluated by ICC-ES under evaluation reports ESR-1153 and ESR-1387 and/or tested in accordance with applicable ASTM standards. For current code evaluation reports, Weyerhaeuser product literature and installation details refer to www.weyerhaeuser.com/woodproducts/ document-library. The product application, input design loads, dimensions and support information have been provided by ForteWEB Software Operator Weyerhaeuser Notes Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Roof: Joist J1 1 piece(s) 2 x 4 DF No.2 @ 24" OC ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 2 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 6 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)302 @ 2 1/2" 2231 (3.50") Passed (14%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)255 @ 8 11/16"1238 Passed (21%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)637 @ 4' 7 1/2"1060 Passed (60%) 1.25 1.0 D + 1.0 Lr (All Spans) Live Load Defl. (in)0.183 @ 4' 7 1/2" 0.466 Passed (L/611) -- 1.0 D + 1.0 Lr (All Spans) Total Load Defl. (in)0.299 @ 4' 7 1/2" 0.621 Passed (L/374) -- 1.0 D + 1.0 Lr (All Spans) Member Length : 9' 10 13/16" System : Roof Member Type : Joist Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD Member Pitch : 4/12 • Deflection criteria: LL (L/240) and TL (L/180). • Allowed moment does not reflect the adjustment for the beam stability factor. • A 15% increase in the moment capacity has been added to account for repetitive member usage. • Applicable calculations are based on NDS. • Blocking Panels are assumed to carry no loads applied directly above them and the full load is applied to the member being designed. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Beveled Plate - SPF 3.50" 3.50" 1.50" 117 185 302 Blocking 2 - Beveled Plate - SPF 3.50" 3.50" 1.50" 117 185 302 Blocking •Maximum allowable bracing intervals based on applied load. •Dimensions for lateral bracing intervals are measured along the length of the member for sloped conditions. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)9' 9" o/c Bottom Edge (Lu)9' 9" o/c Dead Roof Live Vertical Load Location (Side)Spacing (0.90)(1.25)Comments 1 - Uniform (PSF)0 to 9' 3"24"12.0 20.0 Default Load Weyerhaeuser warrants that the sizing of its products will be in accordance with Weyerhaeuser product design criteria and published design values. Weyerhaeuser expressly disclaims any other warranties related to the software. Use of this software is not intended to circumvent the need for a design professional as determined by the authority having jurisdiction. The designer of record, builder or framer is responsible to assure that this calculation is compatible with the overall project. Accessories (Rim Board, Blocking Panels and Squash Blocks) are not designed by this software. Products manufactured at Weyerhaeuser facilities are third-party certified to sustainable forestry standards. Weyerhaeuser Engineered Lumber Products have been evaluated by ICC-ES under evaluation reports ESR-1153 and ESR-1387 and/or tested in accordance with applicable ASTM standards. For current code evaluation reports, Weyerhaeuser product literature and installation details refer to www.weyerhaeuser.com/woodproducts/ document-library. The product application, input design loads, dimensions and support information have been provided by ForteWEB Software Operator Weyerhaeuser Notes Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Roof: Joist J2 1 piece(s) 2 x 6 DF No.2 @ 24" OC ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 3 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 7 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)271 @ 2 1/2" 2231 (3.50") Passed (12%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)244 @ 10 3/4"1631 Passed (15%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)1170 @ 9' 1/2"1700 Passed (69%) 1.25 1.0 D + 1.0 Lr (All Spans) Live Load Defl. (in)0.575 @ 9' 1/2" 0.883 Passed (L/369) -- 1.0 D + 1.0 Lr (All Spans) Total Load Defl. (in)0.863 @ 9' 1/2" 1.178 Passed (L/246) -- 1.0 D + 1.0 Lr (All Spans) Member Length : 18' 1" System : Roof Member Type : Joist Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD Member Pitch : 0/12 • Deflection criteria: LL (L/240) and TL (L/180). • Allowed moment does not reflect the adjustment for the beam stability factor. • A 15% increase in the moment capacity has been added to account for repetitive member usage. • Applicable calculations are based on NDS. • Blocking Panels are assumed to carry no loads applied directly above them and the full load is applied to the member being designed. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Stud wall - SPF 3.50" 3.50" 1.50" 90 181 271 Blocking 2 - Stud wall - SPF 3.50" 3.50" 1.50" 90 181 271 Blocking •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)8' 2" o/c Bottom Edge (Lu)18' 1" o/c Dead Roof Live Vertical Load Location (Side)Spacing (0.90)(1.25)Comments 1 - Uniform (PSF)0 to 18' 1"24"5.0 10.0 Default Load Weyerhaeuser warrants that the sizing of its products will be in accordance with Weyerhaeuser product design criteria and published design values. Weyerhaeuser expressly disclaims any other warranties related to the software. Use of this software is not intended to circumvent the need for a design professional as determined by the authority having jurisdiction. The designer of record, builder or framer is responsible to assure that this calculation is compatible with the overall project. Accessories (Rim Board, Blocking Panels and Squash Blocks) are not designed by this software. Products manufactured at Weyerhaeuser facilities are third-party certified to sustainable forestry standards. Weyerhaeuser Engineered Lumber Products have been evaluated by ICC-ES under evaluation reports ESR-1153 and ESR-1387 and/or tested in accordance with applicable ASTM standards. For current code evaluation reports, Weyerhaeuser product literature and installation details refer to www.weyerhaeuser.com/woodproducts/ document-library. The product application, input design loads, dimensions and support information have been provided by ForteWEB Software Operator Weyerhaeuser Notes Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Roof: Ceiling Joist J3 1 piece(s) 2 x 8 DF No.2 @ 24" OC ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 4 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 8 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)122 @ 0 3281 (1.50") Passed (4%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)106 @ 3"788 Passed (13%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)115 @ 1' 10 1/2"203 Passed (57%) 1.25 1.0 D + 1.0 Lr (All Spans) Vert Live Load Defl. (in) 0.113 @ 1' 10 1/2" 0.125 Passed (L/398) -- 1.0 D + 1.0 Lr (All Spans) Vert Total Load Defl. (in) 0.185 @ 1' 10 1/2" 0.188 Passed (L/244) -- 1.0 D + 1.0 Lr (All Spans) Lat Member Reaction (lbs)275 @ 3' 9"N/A Passed (N/A) 1.60 1.0 D + 0.6 W Lat Shear (lbs)214 @ 5"1008 Passed (21%) 1.60 1.0 D + 0.6 W Lat Moment (Ft-lbs)258 @ mid-span 534 Passed (48%) 1.60 1.0 D + 0.6 W Lat Deflection (in)0.053 @ mid-span 0.375 Passed (L/846) -- 1.0 D + 0.6 W Bi-Axial Bending 0.74 1.00 Passed (74%) 1.60 1.0 D + 0.45 W + 0.75 L + 0.75 Lr Member Length : 3' 9" System : Wall Member Type : Header Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD • Deflection criteria: LL (L/360) and TL (L/240). • Lateral deflection criteria: Wind (L/120) • Member has been designed in flat (plank) orientation. • Applicable calculations are based on NDS. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Trimmer - SPF 1.50" 1.50" 1.50" 47 75 122 None 2 - Trimmer - SPF 1.50" 1.50" 1.50" 47 75 122 None •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)3' 9" o/c Bottom Edge (Lu)3' 9" o/c Lateral Connections: Simpson Strong-Tie Supports Stud Size Stud Material Connector Type/Model Quantity Nailing Left 2X Spruce-Pine-Fir Angle Connectors A23 1 (8) - 10d x 1 1/2" Right 2X Spruce-Pine-Fir Angle Connectors A23 1 (8) - 10d x 1 1/2" Dead Roof Live Vertical Loads Location Tributary Width (0.90)(1.25)Comments 0 - Self Weight (PLF)0 to 3' 9"N/A 1.3 -- 1 - Uniform (PSF)0 to 3' 9"2'12.0 20.0 Default Load • ASCE/SEI 7 Sec. 30.4: Exposure Category (B), Mean Roof Height (33'), Topographic Factor (1.0), Wind Directionality Factor (0.85), Basic Wind Speed (115), Risk Category(II), Wind Zone (4), GCpi (+/- 0.18), Effective Wind Area determined using full member span and trib. width. • IBC Table 1604.3, footnote f: Deflection checks are performed using 42% of this lateral wind load. Wind Lateral Load Location Tributary Width (1.60)Comments 1 - Uniform (PSF)Full Length 10'24.4 Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Wall: Header B1 1 piece(s) 2 x 4 DF No.2 (Plank) ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 5 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 9 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)661 @ 0 3281 (1.50") Passed (20%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)480 @ 7"2888 Passed (17%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)702 @ 2' 1 1/2"2151 Passed (33%) 1.25 1.0 D + 1.0 Lr (All Spans) Vert Live Load Defl. (in)0.017 @ 2' 1 1/2" 0.142 Passed (L/999+) -- 1.0 D + 1.0 Lr (All Spans) Vert Total Load Defl. (in) 0.029 @ 2' 1 1/2" 0.213 Passed (L/999+) -- 1.0 D + 1.0 Lr (All Spans) Lat Member Reaction (lbs)309 @ 4' 3"N/A Passed (N/A) 1.60 1.0 D + 0.6 W Lat Shear (lbs)248 @ 5"3696 Passed (7%) 1.60 1.0 D + 0.6 W Lat Moment (Ft-lbs)328 @ mid-span 1839 Passed (18%) 1.60 1.0 D + 0.6 W Lat Deflection (in)0.024 @ mid-span 0.425 Passed (L/999+) -- 1.0 D + 0.6 W Bi-Axial Bending 0.35 1.00 Passed (35%) 1.60 1.0 D + 0.45 W + 0.75 L + 0.75 Lr Member Length : 4' 3" System : Wall Member Type : Header Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD • Deflection criteria: LL (L/360) and TL (L/240). • Lateral deflection criteria: Wind (L/120) • Applicable calculations are based on NDS. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Trimmer - SPF 1.50" 1.50" 1.50" 289 372 661 None 2 - Trimmer - SPF 1.50" 1.50" 1.50" 289 372 661 None •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)4' 3" o/c Bottom Edge (Lu)4' 3" o/c Lateral Connections Supports Stud Size Stud Material Connector Type/Model Quantity Nailing Left 2X Spruce-Pine-Fir Nails 10d (0.128" x 3") (End)4 Right 2X Spruce-Pine-Fir Nails 10d (0.128" x 3") (End)4 Dead Roof Live Vertical Loads Location Tributary Width (0.90)(1.25)Comments 0 - Self Weight (PLF)0 to 4' 3"N/A 4.9 -- 1 - Uniform (PSF)0 to 4' 3"8' 9"15.0 20.0 Default Load • ASCE/SEI 7 Sec. 30.4: Exposure Category (B), Mean Roof Height (33'), Topographic Factor (1.0), Wind Directionality Factor (0.85), Basic Wind Speed (115), Risk Category(II), Wind Zone (4), GCpi (+/- 0.18), Effective Wind Area determined using full member span and trib. width. • IBC Table 1604.3, footnote f: Deflection checks are performed using 42% of this lateral wind load. Wind Lateral Load Location Tributary Width (1.60)Comments 1 - Uniform (PSF)Full Length 10'24.2 Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Wall: Header B2 1 piece(s) 4 x 6 DF No.2 ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 7 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 10 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)423 @ 3' 9" 3281 (1.50") Passed (13%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)379 @ 3' 2"2888 Passed (13%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)625 @ 2'2151 Passed (29%) 1.25 1.0 D + 1.0 Lr (All Spans) Vert Live Load Defl. (in) 0.010 @ 1' 10 5/8" 0.125 Passed (L/999+) -- 1.0 D + 1.0 Lr (All Spans) Vert Total Load Defl. (in) 0.017 @ 1' 10 5/8" 0.188 Passed (L/999+) -- 1.0 D + 1.0 Lr (All Spans) Lat Member Reaction (lbs)275 @ 3' 9"N/A Passed (N/A) 1.60 1.0 D + 0.6 W Lat Shear (lbs)214 @ 5"3696 Passed (6%) 1.60 1.0 D + 0.6 W Lat Moment (Ft-lbs)258 @ mid-span 1839 Passed (14%) 1.60 1.0 D + 0.6 W Lat Deflection (in)0.015 @ mid-span 0.375 Passed (L/999+) -- 1.0 D + 0.6 W Bi-Axial Bending 0.30 1.00 Passed (30%) 1.60 1.0 D + 0.45 W + 0.75 L + 0.75 Lr Member Length : 3' 9" System : Wall Member Type : Header Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD • Deflection criteria: LL (L/360) and TL (L/240). • Lateral deflection criteria: Wind (L/120) • Applicable calculations are based on NDS. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Trimmer - SPF 1.50" 1.50" 1.50" 173 214 387 None 2 - Trimmer - SPF 1.50" 1.50" 1.50" 189 234 423 None •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)3' 9" o/c Bottom Edge (Lu)3' 9" o/c Lateral Connections Supports Stud Size Stud Material Connector Type/Model Quantity Nailing Left 2X Spruce-Pine-Fir Nails 10d (0.128" x 3") (End)4 Right 2X Spruce-Pine-Fir Nails 10d (0.128" x 3") (End)4 Dead Roof Live Vertical Loads Location Tributary Width (0.90)(1.25)Comments 0 - Self Weight (PLF)0 to 3' 9"N/A 4.9 -- 1 - Uniform (PSF)0 to 3' 9"2'15.0 20.0 Default Load 2 - Point (lb)2'N/A 231 298 Linked from: Roof: Drop Beam B4, Support 2 Wind Lateral Load Location Tributary Width (1.60)Comments 1 - Uniform (PSF)Full Length 10'24.4 Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Wall: Header B3 1 piece(s) 4 x 6 DF No.2 ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 9 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 11 1123 S Magnolia Ave Unit# 22/19/2025 Design Results Actual @ Location Allowed Result LDF Load: Combination (Pattern) Member Reaction (lbs)528 @ 4' 5" 5206 (3.50") Passed (10%) -- 1.0 D + 1.0 Lr (All Spans) Shear (lbs)394 @ 7"1838 Passed (21%) 1.25 1.0 D + 1.0 Lr (All Spans) Moment (Ft-lbs)521 @ 2' 3 1/2"1005 Passed (52%) 1.25 1.0 D + 1.0 Lr (All Spans) Live Load Defl. (in)0.048 @ 2' 3 1/2" 0.213 Passed (L/999+) -- 1.0 D + 1.0 Lr (All Spans) Total Load Defl. (in)0.085 @ 2' 3 1/2" 0.283 Passed (L/603) -- 1.0 D + 1.0 Lr (All Spans) Member Length : 4' 7" System : Roof Member Type : Drop Beam Building Use : Residential Building Code : IBC 2021 Design Methodology : ASD Member Pitch : 0/12 • Deflection criteria: LL (L/240) and TL (L/180). • Allowed moment does not reflect the adjustment for the beam stability factor. • Applicable calculations are based on NDS. • This product has a square cross section. The analysis engine has checked both edge and plank orientations to allow for either installation. • Blocking Panels are assumed to carry no loads applied directly above them and the full load is applied to the member being designed. Bearing Length Loads to Supports (lbs) Supports Total Available Required Dead Roof Live Factored Accessories 1 - Column Cap - steel 3.50" 3.50" 1.50" 231 298 528 Blocking 2 - Ledger - SPF 3.50" 3.50" 1.50" 231 298 528 Blocking •Maximum allowable bracing intervals based on applied load. Lateral Bracing Bracing Intervals Comments Top Edge (Lu)4' 7" o/c Bottom Edge (Lu)4' 7" o/c • Side loads are assumed to not induce cross-grain tension. Dead Roof Live Vertical Loads Location (Side)Tributary Width (0.90)(1.25)Comments 0 - Self Weight (PLF)0 to 4' 7"N/A 3.1 -- 1 - Uniform (PSF)0 to 4' 7" (Front)6' 6"15.0 20.0 Default Load Weyerhaeuser warrants that the sizing of its products will be in accordance with Weyerhaeuser product design criteria and published design values. Weyerhaeuser expressly disclaims any other warranties related to the software. Use of this software is not intended to circumvent the need for a design professional as determined by the authority having jurisdiction. The designer of record, builder or framer is responsible to assure that this calculation is compatible with the overall project. Accessories (Rim Board, Blocking Panels and Squash Blocks) are not designed by this software. Products manufactured at Weyerhaeuser facilities are third-party certified to sustainable forestry standards. Weyerhaeuser Engineered Lumber Products have been evaluated by ICC-ES under evaluation reports ESR-1153 and ESR-1387 and/or tested in accordance with applicable ASTM standards. For current code evaluation reports, Weyerhaeuser product literature and installation details refer to www.weyerhaeuser.com/woodproducts/ document-library. The product application, input design loads, dimensions and support information have been provided by ForteWEB Software Operator Weyerhaeuser Notes Drawing is Conceptual. All locations are measured from the outside face of left support (or left cantilever end). All dimensions are horizontal (typ.). MEMBER REPORT PASSED Roof Level, Roof: Drop Beam B4 1 piece(s) 4 x 4 DF No.2 ForteWEB Software Operator Job Notes 9/30/2024 3:40:43 PM UTC Michael Bryson n/a (562) 285-9995 paisiello3@gmail.com ForteWEB v3.8, Engine: V8.4.1.24, Data: V8.1.6.3 File Name: 16113.00.ADU 1123 Magnolia Ave Page 11 / 11 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 12 1123 S Magnolia Ave Unit# 22/19/2025 Building Seismic Design Criteria To ASCE 7‐22 1‐Storey Risk Category = II Ie = 1.00 Importance Factor Building Structure Type = All Other R = 6.5 Cd D 0 = 2.5 (for flexible diaphragms per Table 12.2-1 footnote g) SS N S1 = 1.0 SMS hn > 65 ft SM1 T Tdrift = 0.105 s Ts = SD1/SDS SDS = 1.000 used for design per ASCE 7-16 Sec. 12.8.1.3 TL = 8.0 s Cs1 = 0.154 (Eq. 12.8-2) SDS = ⅖SMS Cs2 = SD1/(R /Iₑ)(T/1.5)L )= 1.770 max (Eq. 12.8-3) SD1 = ⅖SM1 Cs3 = 0.044 min (Eq. 12.8-5) V (Eq. 12.8-1) ρV (LRFD) For drift calculations: Cs2 = SD1/(Rx/IeTdrift) = 1.180 max (Eq. 12.8-3) Building Structure Class = Regular Vdrift = Cₛ₁W = 0.154W (Eq. 12.8-1) Diaphragm Flexibility = Flexible*x = (Cdxe/Ie)(Vdrift/V)(Eq. 12.8-15) *or LFRS spaced > 40 ft Seismic Design Category = D Storey Forces (LRFD) Both Directions Elev.Dist. Weight Area k=1.00 Force Shear Tx Storey hx wx Ax Wxhx k Fx fx Vx =0.05FxDx (ft)(psf) (sq. ft.) (kips) (slugs)(kip*ft)(kips) (psf) (kips)(kip*ft) Roof 9.15 20.6 625 12.9 0.40 118 2.0 3.2 2.0 1.8 G 0.00 ‐ ‐ ‐ - - - - - - Total 20.6 625 12.9 0.40 118 2.0 (LRFD) 2.0 1.8 Diaphragm Forces (LRFD) Diaphragm Properties Both Directions Elev.Area Dimension Weight Fₚₓ₍ₘᵢₙ₎=0.2 Fₚₓ₍ₘₐₓ₎=0.4 Storey hx Ax Dx Wpx Wi WpxFi/Wi SDSIeWpx SDSIeWpx Fpx fpx (ft)(sq. ft.) (ft) (kips) (kips) (kips) (kips) (kips) (kips) (psf) Roof 9.15 625 18.0 12.9 12.9 2.0 3.0 6.0 3.0 4.8 G 0.00 ‐ ‐ ‐ - - - - - - Total 625 12.9 12.9 (no amendments) Wx Both Directions A._BEARING_WALL_SYSTEMS 13. Light‐framed walls w/ wood panels or steel sheets hi = 0.530 = 1.480 = 0.7 s (default per Section 11.4.3) = 1.74 Site Class = Ground motion analysis Total Weight = 9.15 ft = 0.105 s = 1 Storey = 2.0 kips = 0.5S1/(R / Ie) = 2.0 kips ‐ 20.6 = 0.807 = 1.160 = 1.21 9.15 ‐ 9.15 Dist. Wt. wpx 20.6 (psf) Storey Height (ft) = 4.0δₓₑ = SDS/(R / Ie) = 0.154W per 12.3.4.2 = 4.0 = Cₛ₁W ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 13 1123 S Magnolia Ave Unit# 22/19/2025 Wood Perforated Shearwall Design to ANSI/AWC SDPWS-2022 East Elevation Wall Geometry Maximum aspect ratio = 2:1 L total length of wall L' length for sill connection L1 0.83:1 Lo1 ho1 (Win) H floor to floor/roof height L2 1.39:1 Lo2 ho2 (Win) h height of wall L3 1.75:1 Lo3 ho3 (Win) b wall stud width L4 0.62:1 Lo4 ho4 (Win) sstud wall stud spacing L5 0.62:1 Li Loi Inter. framing nailing bi Ao ho Wall Forces (LRFD) Shear and overturning loads: VE VW ME MW = 1.0 Concentrated loads: PE1 PW1 PDL1 PLL1 a1 PE2 PW2 PDL2 PLL2 a2 PE3 PW3 PDL3 PLL3 a3 PDLwall f 1 = 0.5 awall Uniformly distributed loads: wE1 wW1 wDL1 wLL1 wE2 wW2 wDL2 wLL2= ±0 plf = 30 plf= 0 plf = 0 lbs = 9.67 ft = 0 lbs = 0 lbs = 0 lbs Lₘₐₓ/ΣLᵢ < 35% requires ρ=1.3 per ASCE 12.3.4.2 b. = 0.75 in = 0.75 in = 0 lbs = 1,339 lbs = 0 lbs = 0.0 kip·ft = ±0 lbs = 10.25 ft @ 6'' O.C. = 990 lbs = 4.58 ft Unblocked = ±0 lbs = ±0 lbs = 984 lbs = 12.83 ft = 15.42 ft = 0.0 kip·ft = 19.42 ft = 8.0 ft = 0 plf = 16'' = ±0 lbs = ±0 lbs = 3.5'' = 20.17 ft = 4.17 ft = 5.75 ft = 4.0 ft = 12.0 ft² = 9.71 ft = 1.83 ft Openings: 2 full-height wall segments: = 15.42 ft = 3.0 ft = ±0 plf = 9.71 ft = 40 plf = 40 plf = 3.17 ft = 3.0 ft = 3.0 ft = 7.83 ft = 4.0 ft = 4.25 ft = 5.92 ft = ±0 lbs = 30 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 14 1123 S Magnolia Ave Unit# 22/19/2025 Load Combinations Design Option: Awall = hL Afhs Co V → Seismic governs SDS SDC =D PC PD PT Case 1 - Seismic Load Direction To The Right: eCR MCR dT1 C2 C2 for occupancy loading eTR = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTR T1 Case 2 - Seismic Load Direction To The Left: eCL MCL dT2 C1 C1 for occupancy loading eTL = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 = MCR/(L-a2-dT1) + VH/Cobi = MCL/(L-a2-dT1) + VH/Cobi = MTL/(L-a2-dT1) - VH/Cobi = -675 lbs = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC = (1.2PDL1+1.6PLL1)/ = hLi = 123.3 ft² = MTR/(L-a2-dT1) - VH/Cobi = 0.80 = Awall / (3Ao + Afhs) = PTeTL - MQ = 990 lbs = 3,140 lbs = 0.80 = 2.31'' = MQ + PCe(L-a1-dT2-eCL) = -675 lbs = 2,235 lbs = 0.0 ft = PTeTR - MQ = 0.0 kip·ft = 29.9 kip·ft = (1.2PDL2 + 1.6PLL2)/ = MQ + PC(L-a2-dT1-eCR) = (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wLLai)) + PQ + (wQai) = 0.975 = 0 lbs = 9.65 ft = 9.65 ft = 0.0 ft = 2.31'' = 2a₁ + CL₁ = 2a₂ + CL₂ = VE = 0 lbs = 1.160 (uplift) (uplift) Neglect dead loads to resist overturning = (0.9-0.2SDS)(PDL+wDLai)) =PD - PQ - (wQai) (neglected) = 2,235 lbs = 155.3 ft² = 0.0 kip·ft = 29.9 kip·ft = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 15 1123 S Magnolia Ave Unit# 22/19/2025 Shear Capacity n PLY 5/16'' 6d vn nominal unit shear capacity common framing @ adjoining panel edges Cub unblocked shearwall adjustment factor per Table 4.3.3.2 CARF aspect ratio factor (determined instead by reducing ΣLᵢ per 4.3.3.4) D LRFD reduction factor for seismic design DVn ≥ V ∴ OK Rim Joist Connection To Top Plate: A34 Framing Angles Z ea. Z'≥ V ∴ OK Bottom Sill Plate Connection To Rim Joist: TE T → net tension force required for perforated shearwalls (4.3.6.4.2.1) 1/2"ø Lag Screws p nscrew Z W D3 Z'≥ V ∴ OK W'p ≥ T ∴ OK Combined Lateral and Withdrawal Loads = Atan(T/V) Z' ≥ V ∴ OK Bottom Sill Plate Connection To Concrete Foundation: 1/2''ø A307 Anchor Bolts nbolt hef anchor bolt embedment < 7'' cac anchor bolt edge distance 2x sill plate with Abrg Shear capacity: V/nbolt Z CΔ Z'≥ V/nbolt ∴ OK sVn ≥ V/nbolt ∴ OK Tension capacity: T/nbolt F'cp ≥ T/nbolt ∴ OK tTn ≥ T/nbolt ∴ OK = L'/s + 1 = 6.04 → use (7) bolts = 3,817 lbs = 1.0 = 3'' FyAs = 12'' Wood Structural Panels = KFWpnscrew = -VL'/bi = W'p)Z'/((W'p)cos2+ Z'sin2) = L'/s + 1 = 6.04 = -1,295 lbs = KFZCpCΔnscrew = -1,295 lbs (100%) @ 48.0'' O.C. = 5'' = PD + TE Per CBC 1905.1.8 → where anchor bolt diameter > ⅝'', or embedment < 7'', or edge distance < 1¾'' then connection to concrete foundations must be calculated using ACI 318 Chapter 17 = 1.0 = 1 side(s) sheathed @ 6'' O.C. = 1,403 lbs = 4,176 lbs = 395 lbs = 8.08 in² = 0.5 in = 3,569 lbs = 52.6° → use (7) screws = 0.8 Sheathing = 390 lbs @ 48.0'' O.C. = 650 lbs = 505 plf = 1,705 lbs = 3,114 lbs = 5,891 lbs = KFZ(L/s+1) = -185 lbs = 141 lbs 3"x3"x0.229" washers = 378 lbs/in = KFFcpCbAbrg FyAs = 6,362 lbs = 7,594 lbs =DnCubCARFvnbi = 0.50 w/ 2x = KFZCΔ @ 233.0'' O.C. ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 16 1123 S Magnolia Ave Unit# 22/19/2025 Overturning Capacity Compression Posts: c = 0.90 KFc cp = 0.90 KFcp KLe/d = (h-3(1.5"))/b ≤ 50 ∴ OK Left side of shearwall Right side of shearwall (1) 4x2 (1) 4x2 d1 d2 AC1 AC2 Fc Fc CF CF Fc* = FcCF Fc* = FcCF Emin E'min = Emin Emin E'min = Emin c for sawn lumber c for sawn lumber FcE FcE Cp Cp F'c = FcCFCp F'c = FcCFCp P ≥ C1 ∴ OK P ≥ C2 ∴ OK Fcp bearing from sill plate end ≥ 3''Fcp bearing from sill plate end ≥ 3'' Cb = (d₁ + 0.375'')/d₁Cb = (d₂ + 0.375'')/d₂ F'cp = FcpCb F'cp = FcpCb P ≥ C1 ∴ OK P ≥ C2 ∴ OK Holdown Anchors: z = 0.65 KFz t = 0.80 KFt Left side of shearwall Right side of shearwall (1)Simpson Holdown Anchor (1)Simpson Holdown Anchor CL db = 0'' dab CL db = 0'' dab Tallow Tallow T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK Ft F't = FtCF Ft F't = FtCF Anet1 Anet2 T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK = 0.5'' = 2,461 lbs (160%) = 580,000 psi = 1.67 D. Fir-Larch = 580,000 psi = 580,000 psi = 1.5'' = 0.8 = 1,350 psi = 616 psi = cKFcF'cAC1 = 698 psi = 661 psi = 0.822Emin/(Kle/d)2 = 1,350 psi = 1.15 = 1,553 psi = 2.40 = nbd2 = zKFznhd(Tallow/1.6) = 6,165 lbs No. 2D. Fir-Larch = 0.397 = 616 psi = cKFcF'cAC2 = 6,990 lbs = 625 psi = 1.25 = cpKFcpF'cAC2 (160%) = 5.16 in² = tKFtF'tAnet2 = 575 psi = 781 psi= 781 psi = 580,000 psi = cpKFcpF'cAC1 = 0.8 = AC1 - d1(db+1/16'') = 0.5'' = 5.25 in² = 1,553 psi = 26.1 = 0.397 DTT2Z = 3.32 = 698 psi = 7,365 lbs= 7,365 lbs = 1.15 = 1.25 = nbd1 = 5.25 in² DTT2Z = 1,825 lbs = 0.8125'' = AC1 - d1(db+1/16'') = 1,825 lbs = 0.8125'' = zKFznhd(Tallow/1.6) = 6,990 lbs = 2,461 lbs = 2.70 No. 2 = 661 psi = 1.5'' = 0.822Emin/(Kle/d)2 = 6,165 lbs = 625 psi = tKFtF'tAnet1 = 5.16 in² = 575 psi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 17 1123 S Magnolia Ave Unit# 22/19/2025 Deflection Cd = 4.5 deflection amplification factor Ie = 1.0 importance factor Risk Category I or II vmax using =1.0 Ga using 6'' spacing for unblocked shearwalls per NDS 4.3.2.2 Case I: Shear Force Direction To The Right E1 a1 (no uplift) w = 8vmaxh3/E1AC1 + vmaxh/1000GaCub + ha1/Li x x < 2.0%OK Case II: Shear Force Direction To The Left E2 a2 (no uplift) w = 8vmaxh3/E2AC2 + vmaxh/1000GaCub + ha2/Li x x < 2.0%OK = 0.039'' + 0.085'' + 0'' = 0.124'' = 1,600,000 psi = Cdw/Ie = 0.556'' = (0.128'')T₂/øT₂ = Cdw/Ie = 0.556'' = 0.452% = 0.452% = 1,600,000 psi = x/H = x/H = 10 kip/in = (0.128'')T₁/øT₁ =V/nCubCARFLi = 0.0'' = 0.0'' = 0.039'' + 0.085'' + 0'' = 0.124'' = 80 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 18 1123 S Magnolia Ave Unit# 22/19/2025 Seismic Reaction Forces With Overstrength Factor Fy anchor bolt yield strength = 2.5 = 1.0 0VE For bottom sill plate conection to rim joist/beam: V  maximum) T  maximum) For bottom sill plate conection to foundation: V  maximum) T  maximum) For holdown anchors: Case 1 - Seismic Load Direction To The Right = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCR MCR 1C2 eTR MTR = PTeTR - 1ME T1 Case 2 - Seismic Load Direction To The Left: = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCL MCL 2C1 eTL = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 (uplift)= MTL/(L-a1-dT2) - 2VEH/Cobi = -1,042 lbs = -1,042 lbs = 3,248 lbs = MCL/(L-a1-dT2) + 2VEH/Cobi = 3,217 lbs = PTeTL - 2ME = 2.5 = 354 lbs/bolt = 12.4 kip·ft = 12.4 kip·ft = 9.65 ft = 1,284 lbs = 9.65 ft = 9.65 ft = 29.9 kip·ft = 9.65 ft = 29.9 kip·ft= PC(L-a1-dT2-eCL) + 2ME = ((PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC = (PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC (uplift) = 1.2Fydab 2/4T2 = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai))= 3,140 lbs (uplift) (uplift) = 2.5 = (TTE/ρ + PD)/nbolt = (TTE/ρ + PD)/nscrew = -463 lbs/screw = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai)) = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT = 3,140 lbs = MCR/(L-a1-dT2) + 1VEH/Cobi = MTR/(L-a2-dT1) - 1VEH/Cobi = ME + PC(L-a2-dT1-eCR) = -463 lbs/bolt = 1.2(0.6FyD2nscrew/4VE = 2,476 lbs = 1,284 lbs = 2.5 = 36 ksi = 1.2FyD2nscrew/4T VVE/nbolt TT/nbolt = 0.72Fydab 2nbolt/4VE = 1.2Fydab 2nbolt/4TE = 2.5 = 1.2Fydab 2/4T1 VVE/nscrew = 354 lbs/screw TT/nscrew ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 19 1123 S Magnolia Ave Unit# 22/19/2025 Wood Perforated Shearwall Design to ANSI/AWC SDPWS-2022 North Elevation Wall Geometry Maximum aspect ratio = 2:1 L total length of wall L' length for sill connection L1 0.78:1 Lo1 ho1 (Door) H floor to floor/roof height L2 1.68:1 Lo2 ho2 (Win) h height of wall L3 1.75:1 Lo3 ho3 (Win) b wall stud width L4 0.62:1 Lo4 ho4 (Win) sstud wall stud spacing L5 0.62:1 Li Loi Inter. framing nailing bi Ao ho Wall Forces (LRFD) Shear and overturning loads: VE VW ME MW = 1.3 Concentrated loads: PE1 PW1 PDL1 PLL1 a1 PE2 PW2 PDL2 PLL2 a2 PE3 PW3 PDL3 PLL3 a3 PDLwall f 1 = 0.5 awall Uniformly distributed loads: wE1 wW1 wDL1 wLL1 wE2 wW2 wDL2 wLL2 Openings: 2 full-height wall segments: = 15.0 ft = 7.0 ft = ±0 plf = 9.0 ft = 40 plf = 40 plf = 3.17 ft = 3.0 ft = 7.0 ft = 7.83 ft = 3.0 ft = 4.25 ft = 5.92 ft = ±0 lbs = 30 plf = 4.17 ft = 4.75 ft = 3.0 ft = 21.0 ft² = 9.0 ft = 1.83 ft = 18.0 ft = 8.0 ft = 0 plf = 16'' = ±0 lbs = ±0 lbs = 3.5'' = 16.75 ft = ±0 lbs = 10.25 ft @ 6'' O.C. = 219 lbs = 4.58 ft Unblocked = ±0 lbs = ±0 lbs = 513 lbs = 12.83 ft = 15.0 ft = 0.0 kip·ft = 0 lbs = 10.25 ft = 0 lbs = 0 lbs = 0 lbs Lₘₐₓ/ΣLᵢ < 35% allows ρ=1.0 per ASCE 12.3.4.2 b. = 0.75 in = 0.75 in = 0 lbs = 1,227 lbs = 0 lbs = 0.0 kip·ft = ±0 plf = 30 plf= 0 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 20 1123 S Magnolia Ave Unit# 22/19/2025 Load Combinations Design Option: Awall = hL Afhs Co V → Seismic governs SDS SDC =D PC PD PT Case 1 - Seismic Load Direction To The Right: eCR MCR dT1 C2 C2 for occupancy loading eTR = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTR T1 Case 2 - Seismic Load Direction To The Left: eCL MCL dT2 C1 C1 for occupancy loading eTL = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 = 1,683 lbs = 144.0 ft² = 0.0 kip·ft = 25.5 kip·ft = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC Neglect dead loads to resist overturning = (0.9-0.2SDS)(PDL+wDLai)) =PD - PQ - (wQai) (neglected) = VE = 0 lbs = 1.160 (uplift) (uplift) = 0 lbs = 8.94 ft = 8.94 ft = 0.0 ft = 2.25'' = 2a₁ + CL₁ = 2a₂ + CL₂ = 0.787 = (1.2PDL2 + 1.6PLL2)/ = MQ + PC(L-a2-dT1-eCR) = (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wLLai)) + PQ + (wQai) = 0.0 ft = PTeTR - MQ = 0.0 kip·ft = 25.5 kip·ft = 0.80 = Awall / (3Ao + Afhs) = PTeTL - MQ = 285 lbs = 2,891 lbs = 0.80 = 2.25'' = MQ + PCe(L-a1-dT2-eCL) = -248 lbs = 1,683 lbs = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC = (1.2PDL1+1.6PLL1)/ = hLi = 120.0 ft² = MTR/(L-a2-dT1) - VH/Cobi = MCL/(L-a2-dT1) + VH/Cobi = MTL/(L-a2-dT1) - VH/Cobi = -248 lbs = MCR/(L-a2-dT1) + VH/Cobi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 21 1123 S Magnolia Ave Unit# 22/19/2025 Shear Capacity n PLY 5/16'' 6d vn nominal unit shear capacity common framing @ adjoining panel edges Cub unblocked shearwall adjustment factor per Table 4.3.3.2 CARF aspect ratio factor (determined instead by reducing ΣLᵢ per 4.3.3.4) D LRFD reduction factor for seismic design DVn ≥ V ∴ OK Rim Joist Connection To Top Plate: A34 Framing Angles Z ea. Z'≥ V ∴ OK Bottom Sill Plate Connection To Rim Joist: TE T → net tension force required for perforated shearwalls (4.3.6.4.2.1) 1/2"ø Lag Screws p nscrew Z W D3 Z'≥ V ∴ OK W'p ≥ T ∴ OK Combined Lateral and Withdrawal Loads = Atan(T/V) Z' ≥ V ∴ OK Bottom Sill Plate Connection To Concrete Foundation: 1/2''ø A307 Anchor Bolts nbolt hef anchor bolt embedment < 7'' cac anchor bolt edge distance 2x sill plate with Abrg Shear capacity: V/nbolt Z CΔ Z'≥ V/nbolt ∴ OK sVn ≥ V/nbolt ∴ OK Tension capacity: T/nbolt F'cp ≥ T/nbolt ∴ OK tTn ≥ T/nbolt ∴ OK =DnCubCARFvnbi = 0.50 w/ 2x = KFZCΔ @ 216.0'' O.C. = KFFcpCbAbrg FyAs = 6,362 lbs = 7,594 lbs = 0.8 Sheathing = 390 lbs @ 48.0'' O.C. = 650 lbs = 505 plf = 1,705 lbs = 3,030 lbs = 5,050 lbs = KFZ(L/s+1) = -53 lbs = 48 lbs 3"x3"x0.229" washers = 378 lbs/in @ 6'' O.C. = 1,403 lbs = 3,710 lbs = 395 lbs = 8.08 in² = 0.5 in = 3,059 lbs = 48.2° → use (6) screws Per CBC 1905.1.8 → where anchor bolt diameter > ⅝'', or embedment < 7'', or edge distance < 1¾'' then connection to concrete foundations must be calculated using ACI 318 Chapter 17 = 1.0 = 1 side(s) sheathed = KFWpnscrew = -VL'/bi = W'p)Z'/((W'p)cos2+ Z'sin2) = L'/s + 1 = 5.19 = -318 lbs = KFZCpCΔnscrew = -318 lbs (100%) @ 48.0'' O.C. = 5'' = PD + TE FyAs = 12'' Wood Structural Panels = L'/s + 1 = 5.19 → use (6) bolts = 3,817 lbs = 1.0 = 3'' ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 22 1123 S Magnolia Ave Unit# 22/19/2025 Overturning Capacity Compression Posts: c = 0.90 KFc cp = 0.90 KFcp KLe/d = (h-3(1.5"))/b ≤ 50 ∴ OK Left side of shearwall Right side of shearwall (1) 4x2 (1) 4x2 d1 d2 AC1 AC2 Fc Fc CF CF Fc* = FcCF Fc* = FcCF Emin E'min = Emin Emin E'min = Emin c for sawn lumber c for sawn lumber FcE FcE Cp Cp F'c = FcCFCp F'c = FcCFCp P ≥ C1 ∴ OK P ≥ C2 ∴ OK Fcp bearing from sill plate end ≥ 3''Fcp bearing from sill plate end ≥ 3'' Cb = (d₁ + 0.375'')/d₁Cb = (d₂ + 0.375'')/d₂ F'cp = FcpCb F'cp = FcpCb P ≥ C1 ∴ OK P ≥ C2 ∴ OK Holdown Anchors: z = 0.65 KFz t = 0.80 KFt Left side of shearwall Right side of shearwall (1)Simpson Holdown Anchor (1)Simpson Holdown Anchor CL db = 0'' dab CL db = 0'' dab Tallow Tallow T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK Ft F't = FtCF Ft F't = FtCF Anet1 Anet2 T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK = 1.5'' = 0.822Emin/(Kle/d)2 = 6,165 lbs = 625 psi = tKFtF'tAnet1 = 5.16 in² = 575 psi = 6,990 lbs = 1,133 lbs = 2.70 No. 2 = 661 psi = 7,365 lbs= 7,365 lbs = 1.15 = 1.25 = nbd1 = 5.25 in² DTT1Z = 840 lbs = 0.75'' = AC1 - d1(db+1/16'') = 840 lbs = 0.75'' = zKFznhd(Tallow/1.6) = 580,000 psi = cpKFcpF'cAC1 = 0.8 = AC1 - d1(db+1/16'') = 0.375'' = 5.25 in² = 1,553 psi = 26.1 = 0.397 DTT1Z = 3.32 = 698 psi = 1.25 = cpKFcpF'cAC2 (160%) = 5.16 in² = tKFtF'tAnet2 = 575 psi = 781 psi= 781 psi = nbd2 = zKFznhd(Tallow/1.6) = 6,165 lbs No. 2D. Fir-Larch = 0.397 = 616 psi = cKFcF'cAC2 = 6,990 lbs = 625 psi = 2.40 = 661 psi = 0.822Emin/(Kle/d)2 = 1,350 psi = 1.15 = 1,553 psi = 0.375'' = 1,133 lbs (160%) = 580,000 psi = 1.67 D. Fir-Larch = 580,000 psi = 580,000 psi = 1.5'' = 0.8 = 1,350 psi = 616 psi = cKFcF'cAC1 = 698 psi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 23 1123 S Magnolia Ave Unit# 22/19/2025 Deflection Cd = 4.5 deflection amplification factor Ie = 1.0 importance factor Risk Category I or II vmax using =1.0 Ga using 6'' spacing for unblocked shearwalls per NDS 4.3.2.2 Case I: Shear Force Direction To The Right E1 a1 (no uplift) w = 8vmaxh3/E1AC1 + vmaxh/1000GaCub + ha1/Li x x < 2.0%OK Case II: Shear Force Direction To The Left E2 a2 (no uplift) w = 8vmaxh3/E2AC2 + vmaxh/1000GaCub + ha2/Li x x < 2.0%OK = 18 plf = 0.0'' = 0.0'' = 0.009'' + 0.019'' + 0'' = 0.028'' = Cdw/Ie = 0.127'' = 0.103% = 0.103% = 1,600,000 psi = x/H = x/H = 10 kip/in = (0.17'')T₁/øT₁ =V/nCubCARFLi = 0.009'' + 0.019'' + 0'' = 0.028'' = 1,600,000 psi = Cdw/Ie = 0.127'' = (0.17'')T₂/øT₂ ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 24 1123 S Magnolia Ave Unit# 22/19/2025 Seismic Reaction Forces With Overstrength Factor Fy anchor bolt yield strength = 2.5 = 1.0 0VE For bottom sill plate conection to rim joist/beam: V  maximum) T  maximum) For bottom sill plate conection to foundation: V  maximum) T  maximum) For holdown anchors: Case 1 - Seismic Load Direction To The Right = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCR MCR 1C2 eTR MTR = PTeTR - 1ME T1 Case 2 - Seismic Load Direction To The Left: = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCL MCL 2C1 eTL = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 (no uplift) = 1.2FyD2nscrew/4T VVE/nbolt TT/nbolt = 0.72Fydab 2nbolt/4VE = 1.2Fydab 2nbolt/4TE = 2.5 = 1.2Fydab 2/4T1 VVE/nscrew = 91 lbs/screw TT/nscrew = 1,180 lbs = 2.5 = 36 ksi = ME + PC(L-a2-dT1-eCR) = -102 lbs/bolt = 1.2(0.6FyD2nscrew/4VE = 548 lbs = PC(L-a1-dT2-eCL) + 2ME = ((PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC = (PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC (uplift) = 1.2Fydab 2/4T2 = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai))= 2,891 lbs (uplift) (no uplift) = 2.5 = (TTE/ρ + PD)/nbolt = (TTE/ρ + PD)/nscrew = -102 lbs/screw = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai)) = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT = 2,891 lbs = MCR/(L-a1-dT2) + 1VEH/Cobi = MTR/(L-a2-dT1) - 1VEH/Cobi = 8.94 ft = 1,180 lbs = 8.94 ft = 8.94 ft = 25.5 kip·ft = 8.94 ft = 25.5 kip·ft = MTL/(L-a1-dT2) - 2VEH/Cobi = +118 lbs = +118 lbs = 1,911 lbs = MCL/(L-a1-dT2) + 2VEH/Cobi = 1,882 lbs = PTeTL - 2ME = 2.5 = 91 lbs/bolt = 10.6 kip·ft = 10.6 kip·ft ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 25 1123 S Magnolia Ave Unit# 22/19/2025 Wood Shearwall Design to ANSI/AWC SDPWS-2022 South Elevation Wall Geometry Maximum aspect ratio = 3.5:1 L total length of wall L' length for sill connection L1 1.14:1 Lo1 ho1 Door H floor to floor/roof height L2 1.1294 Lo2 ho2 Win h height of wall L3 1.75:1 Lo3 ho3 Win b wall stud width L4 0.62:1 Lo4 ho4 Win sstud wall stud spacing L5 0.62:1 Li Loi Inter. framing nailing bi Ao ho Wall Forces (LRFD) Shear and overturning loads: VE VW ME MW = 1.3 Concentrated loads: PE1 PW1 PDL1 PLL1 a1 PE2 PW2 PDL2 PLL2 a2 PE3 PW3 PDL3 PLL3 a3 PDLwall f 1 = 0.5 awall Uniformly distributed loads: wE1 wW1 wDL1 wLL1 wE2 wW2 wDL2 wLL2= ±0 plf = 30 plf= 0 plf = 0 lbs = 7.0 ft = 0 lbs = 0 lbs = 0 lbs = 0.75 in = 0.75 in = 0 lbs = 425 lbs = 0 lbs = 0.0 kip·ft = ±0 lbs = 10.25 ft @ 6'' O.C. = 1,112 lbs = 4.58 ft Blocked = ±0 lbs = ±0 lbs = 984 lbs = 12.83 ft = 6.74 ft = 0.0 kip·ft = 7.0 ft = 8.0 ft = 0 plf = 16'' = ±0 lbs = ±0 lbs = 3.5'' = 5.75 ft 4.1667 7.0833 0 0 = 3.5 ft 1.8333 Openings: 1 full-height wall segment = 7.0 ft 0 = ±0 plf = 3.5 ft = 40 plf = 40 plf 3.1667 3 7 7.8333 2.8333 = 4.25 ft 5.91667 = ±0 lbs = 30 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 26 1123 S Magnolia Ave Unit# 22/19/2025 Load Combinations Design Option: Awall = hL Afhs Co V → Seismic governs SDS SDC =D PC PD PT Case 1 - Seismic Load Direction To The Right: eCR MCR dT1 C2 C2 for occupancy loading eTR = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTR T1 Case 2 - Seismic Load Direction To The Left: eCL MCL dT2 C1 C1 for occupancy loading eTL = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 = MCR/(L-a2-dT1) + VH/Cobi = MCL/(L-a2-dT1) + VH/Cobi = MTL/(L-a2-dT1) - VH/Cobi = -2,196 lbs = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC = (1.2PDL1+1.6PLL1)/ = hLi = 56.0 ft² = MTR/(L-a2-dT1) - VH/Cobi = 0.80 = Awall / (3Ao + Afhs) = PTeTL - MQ = 1,445 lbs = 1,049 lbs = 0.80 = 2.31'' = MQ + PCe(L-a1-dT2-eCL) = -2,196 lbs = 2,710 lbs = 0.0 ft = PTeTR - MQ = 0.0 kip·ft = 3.5 kip·ft = (1.2PDL2 + 1.6PLL2)/ = MQ + PC(L-a2-dT1-eCR) = (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wLLai)) + PQ + (wQai) = 1.0 = 0 lbs = 3.44 ft = 3.44 ft = 0.0 ft = 2.31'' = 2a₁ + CL₁ = 2a₂ + CL₂ = VE = 0 lbs = 1.160 (uplift) (uplift) Neglect dead loads to resist overturning = (0.9-0.2SDS)(PDL+wDLai)) =PD - PQ - (wQai) (neglected) = 2,710 lbs = 56.0 ft² = 0.0 kip·ft = 3.5 kip·ft = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 27 1123 S Magnolia Ave Unit# 22/19/2025 Shear Capacity n PLY 5/16'' 6d vn nominal unit shear capacity common framing @ adjoining panel edges Cub unblocked shearwall adjustment factor per Table 4.3.3.2 CARF aspect ratio factor D LRFD reduction factor for seismic design DVn ≥ V ∴ OK Rim Joist Connection To Top Plate: A34 Framing Angles Z ea. Z'≥ V ∴ OK TE T → no net tension force required for perforated shearwalls (4.3.6.4.2.1) Bottom Sill Plate Connection To Rim Joist: 1/2"ø Lag Screws p nscrew Z W D3 Z'≥ V ∴ OK W'p ≥ T ∴ OK Combined Lateral and Withdrawal Loads = Atan(T/V) Z' ≥ V ∴ OK Bottom Sill Plate Connection To Concrete Foundation: 1/2''ø A307 Anchor Bolts nbolt hef anchor bolt embedment < 7'' cac anchor bolt edge distance 2x sill plate with Abrg Shear capacity: V/nbolt Z CΔ Z'≥ V/nbolt ∴ OK sVn ≥ V/nbolt ∴ OK Tension capacity: T/nbolt F'cp ≥ T/nbolt ∴ OK tTn ≥ T/nbolt ∴ OK = L'/s + 1 = 2.44 → use (3) bolts = 3,817 lbs = 1.0 = 3'' FyAs = 12'' Wood Structural Panels = KFWpnscrew = -VL'/bi = W'p)Z'/((W'p)cos2+ Z'sin2) = L'/s + 1 = 2.44 = 0 lbs = KFZCpCΔnscrew = 0 lbs (100%) @ 48.0'' O.C. = 5'' = PD + TE Per CBC 1905.1.8 → where anchor bolt diameter > ⅝'', or embedment < 7'', or edge distance < 1¾'' then connection to concrete foundations must be calculated using ACI 318 Chapter 17 = 1.0 = 1 side(s) sheathed @ 6'' O.C. = 1,403 lbs = 2,525 lbs = 395 lbs = 8.08 in² = 0.5 in = 1,529 lbs = 0.0° → use (3) screws = 1.0 Sheathing = 390 lbs @ 48.0'' O.C. = 650 lbs = 505 plf = 1,705 lbs = 1,703 lbs = 2,525 lbs = KFZ(L/s+1) = 0 lbs = 482 lbs standard cut washers = 378 lbs/in = KFFcpCbAbrg FyAs = 6,362 lbs = 7,594 lbs =DnCubCARFvnbi = 0.50 w/ 2x = KFZCΔ @ 84.0'' O.C. ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 28 1123 S Magnolia Ave Unit# 22/19/2025 Overturning Capacity Compression Posts: c = 0.90 KFc cp = 0.90 KFcp KLe/d = (h-3(1.5"))/b ≤ 50 ∴ OK Left side of shearwall Right side of shearwall (1) 4x2 (1) 4x2 d1 d2 AC1 AC2 Fc Fc CF CF Fc* = FcCF Fc* = FcCF Emin E'min = Emin Emin E'min = Emin c for sawn lumber c for sawn lumber FcE FcE Cp Cp F'c = FcCFCp F'c = FcCFCp P ≥ C1 ∴ OK P ≥ C2 ∴ OK Fcp bearing from sill plate end ≥ 3''Fcp bearing from sill plate end ≥ 3'' Cb = (d₁ + 0.375'')/d₁Cb = (d₂ + 0.375'')/d₂ F'cp = FcpCb F'cp = FcpCb P ≥ C1 ∴ OK P ≥ C2 ∴ OK Holdown Anchors: z = 0.65 KFz t = 0.80 KFt Left side of shearwall Right side of shearwall (1)Simpson Holdown Anchor (1)Simpson Holdown Anchor CL db = 0'' dab CL db = 0'' dab Tallow Tallow T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK Ft F't = FtCF Ft F't = FtCF Anet1 Anet2 T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK = 0.5'' = 2,461 lbs (160%) = 580,000 psi = 1.67 D. Fir-Larch = 580,000 psi = 580,000 psi = 1.5'' = 0.8 = 1,350 psi = 616 psi = cKFcF'cAC1 = 698 psi = 661 psi = 0.822Emin/(Kle/d)2 = 1,350 psi = 1.15 = 1,553 psi = 2.40 = nbd2 = zKFznhd(Tallow/1.6) = 6,165 lbs No. 2D. Fir-Larch = 0.397 = 616 psi = cKFcF'cAC2 = 6,990 lbs = 625 psi = 1.25 = cpKFcpF'cAC2 (160%) = 5.16 in² = tKFtF'tAnet2 = 575 psi = 781 psi= 781 psi = 580,000 psi = cpKFcpF'cAC1 = 0.8 = AC1 - d1(db+1/16'') = 0.5'' = 5.25 in² = 1,553 psi = 26.1 = 0.397 DTT2Z = 3.32 = 698 psi = 7,365 lbs= 7,365 lbs = 1.15 = 1.25 = nbd1 = 5.25 in² DTT2Z = 1,825 lbs = 0.8125'' = AC1 - d1(db+1/16'') = 1,825 lbs = 0.8125'' = zKFznhd(Tallow/1.6) = 6,990 lbs = 2,461 lbs = 2.70 No. 2 = 661 psi = 1.5'' = 0.822Emin/(Kle/d)2 = 6,165 lbs = 625 psi = tKFtF'tAnet1 = 5.16 in² = 575 psi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 29 1123 S Magnolia Ave Unit# 22/19/2025 Deflection Cd = 4.5 deflection amplification factor Ie = 1.0 importance factor Risk Category I or II vmax using =1.0 Ga Case I: Shear Force Direction To The Right E1 a1 (no uplift) w = 8vmaxh3/E1AC1 + vmaxh/1000GaCub + ha1/Li x x < 2.0%OK Case II: Shear Force Direction To The Left E2 a2 (no uplift) w = 8vmaxh3/E2AC2 + vmaxh/1000GaCub + ha2/Li x x < 2.0%OK = 0.077'' + 0.134'' + 0'' = 0.211'' = 1,600,000 psi = Cdw/Ie = 0.95'' = (0.128'')T₂/øT₂ = Cdw/Ie = 0.95'' = 0.772% = 0.772% = 1,600,000 psi = x/H = x/H = 10 kip/in = (0.128'')T₁/øT₁ =V/nCubCARFLi = 0.0'' = 0.0'' = 0.077'' + 0.134'' + 0'' = 0.211'' = 159 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 30 1123 S Magnolia Ave Unit# 22/19/2025 Seismic Reaction Forces With Overstrength Factor Fy anchor bolt yield strength = 2.5 = 1.0 0VE For bottom sill plate conection to rim joist/beam: V  maximum) T  maximum) For bottom sill plate conection to foundation: V  maximum) T  maximum) For holdown anchors: Case 1 - Seismic Load Direction To The Right = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCR MCR 1C2 eTR MTR = PTeTR - 1ME T1 Case 2 - Seismic Load Direction To The Left: = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCL MCL 2C1 eTL = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 (uplift)= MTL/(L-a1-dT2) - 2VEH/Cobi = -4,007 lbs = -4,007 lbs = 4,737 lbs = MCL/(L-a1-dT2) + 2VEH/Cobi = 4,709 lbs = PTeTL - 2ME = 2.5 = 926 lbs/bolt = 1.5 kip·ft = 1.5 kip·ft = 3.44 ft = 424 lbs = 3.44 ft = 3.44 ft = 3.5 kip·ft = 3.44 ft = 3.5 kip·ft= PC(L-a1-dT2-eCL) + 2ME = ((PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC = (PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC (no uplift) = 1.2Fydab 2/4T2 = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai))= 1,049 lbs (no uplift) (uplift) = 2.5 = (TTE/ρ + PD)/nbolt = (TTE/ρ + PD)/nscrew = 0 lbs/screw = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai)) = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT = 1,049 lbs = MCR/(L-a1-dT2) + 1VEH/Cobi = MTR/(L-a2-dT1) - 1VEH/Cobi = ME + PC(L-a2-dT1-eCR) = 0 lbs/bolt = 1.2(0.6FyD2nscrew/4VE = 2,779 lbs = 424 lbs = 2.5 = 36 ksi = 1.2FyD2nscrew/4T VVE/nbolt TT/nbolt = 0.72Fydab 2nbolt/4VE = 1.2Fydab 2nbolt/4TE = 2.5 = 1.2Fydab 2/4T1 VVE/nscrew = 926 lbs/screw TT/nscrew ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 31 1123 S Magnolia Ave Unit# 22/19/2025 Wood Shearwall Design to ANSI/AWC SDPWS-2022 West Elevation Wall Geometry Maximum aspect ratio = 2:1 L total length of wall L' length for sill connection L1 0.41:1 Lo1 ho1 Win H floor to floor/roof height L2 1.3913 Lo2 ho2 Win h height of wall L3 1.75:1 Lo3 ho3 Win b wall stud width L4 0.62:1 Lo4 ho4 Win sstud wall stud spacing L5 0.62:1 Li Loi Inter. framing nailing bi Ao ho Wall Forces (LRFD) Shear and overturning loads: VE VW ME MW = 1.0 Concentrated loads: PE1 PW1 PDL1 PLL1 a1 PE2 PW2 PDL2 PLL2 a2 PE3 PW3 PDL3 PLL3 a3 PDLwall f 1 = 0.5 awall Uniformly distributed loads: wE1 wW1 wDL1 wLL1 wE2 wW2 wDL2 wLL2 Openings: 1 full-height wall segment = 19.42 ft 0 = ±0 plf = 9.71 ft = 40 plf = 40 plf 3.1667 3 3 7.8333 4 = 4.25 ft 5.91667 = ±0 lbs = 30 plf 4.1667 5.75 0 0 = 9.71 ft 1.8333 = 19.42 ft = 8.0 ft = 0 plf = 16'' = ±0 lbs = ±0 lbs = 3.5'' = 18.17 ft = ±0 lbs = 10.25 ft @ 6'' O.C. = 990 lbs = 4.58 ft Unblocked = ±0 lbs = ±0 lbs = 984 lbs = 12.83 ft = 19.16 ft = 0.0 kip·ft = 0 lbs = 19.42 ft = 0 lbs = 0 lbs = 0 lbs = 0.75 in = 0.75 in = 0 lbs = 1,339 lbs = 0 lbs = 0.0 kip·ft = ±0 plf = 30 plf= 0 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 32 1123 S Magnolia Ave Unit# 22/19/2025 Load Combinations Design Option: Awall = hL Afhs Co V → Seismic governs SDS SDC =D PC PD PT Case 1 - Seismic Load Direction To The Right: eCR MCR dT1 C2 C2 for occupancy loading eTR = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTR T1 Case 2 - Seismic Load Direction To The Left: eCL MCL dT2 C1 C1 for occupancy loading eTL = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 = 2,089 lbs = 155.3 ft² = 0.0 kip·ft = 29.9 kip·ft = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC Neglect dead loads to resist overturning = (0.9-0.2SDS)(PDL+wDLai)) =PD - PQ - (wQai) (neglected) = VE = 0 lbs = 1.160 (uplift) (uplift) = 0 lbs = 9.65 ft = 9.65 ft = 0.0 ft = 2.31'' = 2a₁ + CL₁ = 2a₂ + CL₂ = 1.0 = (1.2PDL2 + 1.6PLL2)/ = MQ + PC(L-a2-dT1-eCR) = (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wLLai)) + PQ + (wQai) = 0.0 ft = PTeTR - MQ = 0.0 kip·ft = 29.9 kip·ft = 0.80 = Awall / (3Ao + Afhs) = PTeTL - MQ = 990 lbs = 3,140 lbs = 0.80 = 2.31'' = MQ + PCe(L-a1-dT2-eCL) = -530 lbs = 2,089 lbs = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC = (1.2PDL1+1.6PLL1)/ = hLi = 155.3 ft² = MTR/(L-a2-dT1) - VH/Cobi = MCL/(L-a2-dT1) + VH/Cobi = MTL/(L-a2-dT1) - VH/Cobi = -530 lbs = MCR/(L-a2-dT1) + VH/Cobi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 33 1123 S Magnolia Ave Unit# 22/19/2025 Shear Capacity n PLY 5/16'' 6d vn nominal unit shear capacity common framing @ adjoining panel edges Cub unblocked shearwall adjustment factor per Table 4.3.3.2 CARF aspect ratio factor D LRFD reduction factor for seismic design DVn ≥ V ∴ OK Rim Joist Connection To Top Plate: A34 Framing Angles Z ea. Z'≥ V ∴ OK Bottom Sill Plate Connection To Rim Joist: TE T → no net tension force required for perforated shearwalls (4.3.6.4.2.1) 1/2"ø Lag Screws p nscrew Z W D3 Z'≥ V ∴ OK W'p ≥ T ∴ OK Combined Lateral and Withdrawal Loads = Atan(T/V) Z' ≥ V ∴ OK Bottom Sill Plate Connection To Concrete Foundation: 1/2''ø A307 Anchor Bolts nbolt hef anchor bolt embedment < 7'' cac anchor bolt edge distance 2x sill plate with Abrg Shear capacity: V/nbolt Z CΔ Z'≥ V/nbolt ∴ OK sVn ≥ V/nbolt ∴ OK Tension capacity: T/nbolt F'cp ≥ T/nbolt ∴ OK tTn ≥ T/nbolt ∴ OK =DnCubCARFvnbi = 0.50 w/ 2x = KFZCΔ @ 233.0'' O.C. = KFFcpCbAbrg FyAs = 6,362 lbs = 7,594 lbs = 0.8 Sheathing = 390 lbs @ 48.0'' O.C. = 650 lbs = 505 plf = 1,705 lbs = 3,871 lbs = 5,050 lbs = KFZ(L/s+1) = 0 lbs = 165 lbs standard cut washers = 378 lbs/in @ 6'' O.C. = 1,403 lbs = 5,050 lbs = 395 lbs = 8.08 in² = 0.5 in = 3,059 lbs = 0.0° → use (6) screws Per CBC 1905.1.8 → where anchor bolt diameter > ⅝'', or embedment < 7'', or edge distance < 1¾'' then connection to concrete foundations must be calculated using ACI 318 Chapter 17 = 1.0 = 1 side(s) sheathed = KFWpnscrew = -VL'/bi = W'p)Z'/((W'p)cos2+ Z'sin2) = L'/s + 1 = 5.54 = 0 lbs = KFZCpCΔnscrew = 0 lbs (100%) @ 48.0'' O.C. = 5'' = PD + TE FyAs = 12'' Wood Structural Panels = L'/s + 1 = 5.54 → use (6) bolts = 3,817 lbs = 1.0 = 3'' ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 34 1123 S Magnolia Ave Unit# 22/19/2025 Overturning Capacity Compression Posts: c = 0.90 KFc cp = 0.90 KFcp KLe/d = (h-3(1.5"))/b ≤ 50 ∴ OK Left side of shearwall Right side of shearwall (1) 4x2 (1) 4x2 d1 d2 AC1 AC2 Fc Fc CF CF Fc* = FcCF Fc* = FcCF Emin E'min = Emin Emin E'min = Emin c for sawn lumber c for sawn lumber FcE FcE Cp Cp F'c = FcCFCp F'c = FcCFCp P ≥ C1 ∴ OK P ≥ C2 ∴ OK Fcp bearing from sill plate end ≥ 3''Fcp bearing from sill plate end ≥ 3'' Cb = (d₁ + 0.375'')/d₁Cb = (d₂ + 0.375'')/d₂ F'cp = FcpCb F'cp = FcpCb P ≥ C1 ∴ OK P ≥ C2 ∴ OK Holdown Anchors: z = 0.65 KFz t = 0.80 KFt Left side of shearwall Right side of shearwall (1)Simpson Holdown Anchor (1)Simpson Holdown Anchor CL db = 0'' dab CL db = 0'' dab Tallow Tallow T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK Ft F't = FtCF Ft F't = FtCF Anet1 Anet2 T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK = 1.5'' = 0.822Emin/(Kle/d)2 = 6,165 lbs = 625 psi = tKFtF'tAnet1 = 5.16 in² = 575 psi = 6,990 lbs = 2,461 lbs = 2.70 No. 2 = 661 psi = 7,365 lbs= 7,365 lbs = 1.15 = 1.25 = nbd1 = 5.25 in² DTT2Z = 1,825 lbs = 0.8125'' = AC1 - d1(db+1/16'') = 1,825 lbs = 0.8125'' = zKFznhd(Tallow/1.6) = 580,000 psi = cpKFcpF'cAC1 = 0.8 = AC1 - d1(db+1/16'') = 0.5'' = 5.25 in² = 1,553 psi = 26.1 = 0.397 DTT2Z = 3.32 = 698 psi = 1.25 = cpKFcpF'cAC2 (160%) = 5.16 in² = tKFtF'tAnet2 = 575 psi = 781 psi= 781 psi = nbd2 = zKFznhd(Tallow/1.6) = 6,165 lbs No. 2D. Fir-Larch = 0.397 = 616 psi = cKFcF'cAC2 = 6,990 lbs = 625 psi = 2.40 = 661 psi = 0.822Emin/(Kle/d)2 = 1,350 psi = 1.15 = 1,553 psi = 0.5'' = 2,461 lbs (160%) = 580,000 psi = 1.67 D. Fir-Larch = 580,000 psi = 580,000 psi = 1.5'' = 0.8 = 1,350 psi = 616 psi = cKFcF'cAC1 = 698 psi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 35 1123 S Magnolia Ave Unit# 22/19/2025 Deflection Cd = 4.5 deflection amplification factor Ie = 1.0 importance factor Risk Category I or II vmax using =1.0 Ga using 6'' spacing for unblocked shearwalls per NDS 4.3.2.2 Case I: Shear Force Direction To The Right E1 a1 (no uplift) w = 8vmaxh3/E1AC1 + vmaxh/1000GaCub + ha1/Li x x < 2.0%OK Case II: Shear Force Direction To The Left E2 a2 (no uplift) w = 8vmaxh3/E2AC2 + vmaxh/1000GaCub + ha2/Li x x < 2.0%OK = 64 plf = 0.0'' = 0.0'' = 0.031'' + 0.067'' + 0'' = 0.098'' = Cdw/Ie = 0.442'' = 0.359% = 0.359% = 1,600,000 psi = x/H = x/H = 10 kip/in = (0.128'')T₁/øT₁ =V/nCubCARFLi = 0.031'' + 0.067'' + 0'' = 0.098'' = 1,600,000 psi = Cdw/Ie = 0.442'' = (0.128'')T₂/øT₂ ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 36 1123 S Magnolia Ave Unit# 22/19/2025 Seismic Reaction Forces With Overstrength Factor Fy anchor bolt yield strength = 2.5 = 1.0 0VE For bottom sill plate conection to rim joist/beam: V  maximum) T  maximum) For bottom sill plate conection to foundation: V  maximum) T  maximum) For holdown anchors: Case 1 - Seismic Load Direction To The Right = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCR MCR 1C2 eTR MTR = PTeTR - 1ME T1 Case 2 - Seismic Load Direction To The Left: = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCL MCL 2C1 eTL = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 (uplift) = 1.2FyD2nscrew/4T VVE/nbolt TT/nbolt = 0.72Fydab 2nbolt/4VE = 1.2Fydab 2nbolt/4TE = 2.5 = 1.2Fydab 2/4T1 VVE/nscrew = 413 lbs/screw TT/nscrew = 1,284 lbs = 2.5 = 36 ksi = ME + PC(L-a2-dT1-eCR) = 0 lbs/bolt = 1.2(0.6FyD2nscrew/4VE = 2,476 lbs = PC(L-a1-dT2-eCL) + 2ME = ((PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC = (PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC (no uplift) = 1.2Fydab 2/4T2 = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai))= 3,140 lbs (no uplift) (uplift) = 2.5 = (TTE/ρ + PD)/nbolt = (TTE/ρ + PD)/nscrew = 0 lbs/screw = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai)) = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT = 3,140 lbs = MCR/(L-a1-dT2) + 1VEH/Cobi = MTR/(L-a2-dT1) - 1VEH/Cobi = 9.65 ft = 1,284 lbs = 9.65 ft = 9.65 ft = 29.9 kip·ft = 9.65 ft = 29.9 kip·ft = MTL/(L-a1-dT2) - 2VEH/Cobi = -678 lbs = -678 lbs = 2,884 lbs = MCL/(L-a1-dT2) + 2VEH/Cobi = 2,853 lbs = PTeTL - 2ME = 2.5 = 413 lbs/bolt = 12.4 kip·ft = 12.4 kip·ft ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 37 1123 S Magnolia Ave Unit# 22/19/2025 Wood Perforated Shearwall Design to ANSI/AWC SDPWS-2022 Interior Wall Geometry Maximum aspect ratio = 3.5:1 L total length of wall L' length for sill connection L1 3.2:1 Lo1 ho1 (Door) H floor to floor/roof height L2 1.63:1 Lo2 ho2 (Win) h height of wall L3 1.75:1 Lo3 ho3 (Win) b wall stud width L4 0.62:1 Lo4 ho4 (Win) sstud wall stud spacing L5 0.62:1 Li Loi Inter. framing nailing bi Ao ho Wall Forces (LRFD) Shear and overturning loads: VE VW ME MW = 1.3 Concentrated loads: PE1 PW1 PDL1 PLL1 a1 PE2 PW2 PDL2 PLL2 a2 PE3 PW3 PDL3 PLL3 a3 PDLwall f 1 = 0.5 awall Uniformly distributed loads: wE1 wW1 wDL1 wLL1 wE2 wW2 wDL2 wLL2= ±0 plf = 30 plf= 0 plf = 0 lbs = 2.5 ft = 0 lbs = 0 lbs = 0 lbs = 0.75 in = 0.75 in = 0 lbs = 677 lbs = 0 lbs = 0.0 kip·ft = ±0 lbs = 10.25 ft @ 6'' O.C. = 658 lbs = 4.58 ft Blocked = ±0 lbs = ±0 lbs = 1,911 lbs = 12.83 ft = 6.48 ft = 0.0 kip·ft = 10.42 ft = 8.0 ft = 0 plf = 16'' = ±0 lbs = ±0 lbs = 3.5'' = 9.17 ft = 4.17 ft = 4.92 ft = 3.0 ft = 21.0 ft² = 5.21 ft = 1.83 ft Openings: 2 full-height wall segments: = 7.42 ft = 7.0 ft = ±0 plf = 5.21 ft = 40 plf = 40 plf = 3.17 ft = 3.0 ft = 7.0 ft = 7.83 ft = 3.0 ft = 4.25 ft = 5.92 ft = ±0 lbs = 30 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 38 1123 S Magnolia Ave Unit# 22/19/2025 Load Combinations Design Option: Awall = hL Afhs Co V → Seismic governs SDS SDC =D PC PD PT Case 1 - Seismic Load Direction To The Right: eCR MCR dT1 C2 C2 for occupancy loading eTR = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTR T1 Case 2 - Seismic Load Direction To The Left: eCL MCL dT2 C1 C1 for occupancy loading eTL = PQai)+(wQai 2/2)+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 = MCR/(L-a2-dT1) + VH/Cobi = MCL/(L-a2-dT1) + VH/Cobi = MTL/(L-a2-dT1) - VH/Cobi = -1,987 lbs = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC = (1.2PDL1+1.6PLL1)/ = hLi = 59.3 ft² = MTR/(L-a2-dT1) - VH/Cobi = 0.80 = Awall / (3Ao + Afhs) = PTeTL - MQ = 856 lbs = 1,625 lbs = 0.80 = 2.31'' = MQ + PCe(L-a1-dT2-eCL) = -1,987 lbs = 2,789 lbs = 0.0 ft = PTeTR - MQ = 0.0 kip·ft = 8.1 kip·ft = (1.2PDL2 + 1.6PLL2)/ = MQ + PC(L-a2-dT1-eCR) = (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wLLai)) + PQ + (wQai) = 0.681 = 0 lbs = 5.15 ft = 5.15 ft = 0.0 ft = 2.31'' = 2a₁ + CL₁ = 2a₂ + CL₂ = VE = 0 lbs = 1.160 (uplift) (uplift) Neglect dead loads to resist overturning = (0.9-0.2SDS)(PDL+wDLai)) =PD - PQ - (wQai) (neglected) = 2,789 lbs = 83.3 ft² = 0.0 kip·ft = 8.1 kip·ft = PQai)+(wQai 2/2)+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wLLai 2/2)) / PC ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 39 1123 S Magnolia Ave Unit# 22/19/2025 Shear Capacity n PLY 5/16'' 6d vn nominal unit shear capacity common framing @ adjoining panel edges Cub unblocked shearwall adjustment factor per Table 4.3.3.2 CARF aspect ratio factor (determined instead by reducing ΣLᵢ per 4.3.3.4) D LRFD reduction factor for seismic design DVn ≥ V ∴ OK Rim Joist Connection To Top Plate: A34 Framing Angles Z ea. Z'≥ V ∴ OK Bottom Sill Plate Connection To Rim Joist: TE T → net tension force required for perforated shearwalls (4.3.6.4.2.1) 1/2"ø Lag Screws p nscrew Z W D3 Z'≥ V ∴ OK W'p ≥ T ∴ OK Combined Lateral and Withdrawal Loads = Atan(T/V) Z' ≥ V ∴ OK Bottom Sill Plate Connection To Concrete Foundation: 1/2''ø A307 Anchor Bolts nbolt hef anchor bolt embedment < 7'' cac anchor bolt edge distance 2x sill plate with Abrg Shear capacity: V/nbolt Z CΔ Z'≥ V/nbolt ∴ OK sVn ≥ V/nbolt ∴ OK Tension capacity: T/nbolt F'cp ≥ T/nbolt ∴ OK tTn ≥ T/nbolt ∴ OK = L'/s + 1 = 3.29 → use (4) bolts = 3,817 lbs = 1.0 = 3'' FyAs = 12'' Wood Structural Panels = KFWpnscrew = -VL'/bi = W'p)Z'/((W'p)cos2+ Z'sin2) = L'/s + 1 = 3.29 = -1,210 lbs = KFZCpCΔnscrew = -1,210 lbs (100%) @ 48.0'' O.C. = 5'' = PD + TE Per CBC 1905.1.8 → where anchor bolt diameter > ⅝'', or embedment < 7'', or edge distance < 1¾'' then connection to concrete foundations must be calculated using ACI 318 Chapter 17 = 1.0 = 1 side(s) sheathed @ 6'' O.C. = 1,403 lbs = 2,348 lbs = 395 lbs = 8.08 in² = 0.5 in = 2,039 lbs = 54.7° → use (4) screws = 1.0 Sheathing = 390 lbs @ 48.0'' O.C. = 650 lbs = 505 plf = 1,705 lbs = 1,636 lbs = 3,366 lbs = KFZ(L/s+1) = -303 lbs = 214 lbs 3"x3"x0.229" washers = 378 lbs/in = KFFcpCbAbrg FyAs = 6,362 lbs = 7,594 lbs =DnCubCARFvnbi = 0.50 w/ 2x = KFZCΔ @ 125.0'' O.C. ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 40 1123 S Magnolia Ave Unit# 22/19/2025 Overturning Capacity Compression Posts: c = 0.90 KFc cp = 0.90 KFcp KLe/d = (h-3(1.5"))/b ≤ 50 ∴ OK Left side of shearwall Right side of shearwall (1) 4x2 (1) 4x2 d1 d2 AC1 AC2 Fc Fc CF CF Fc* = FcCF Fc* = FcCF Emin E'min = Emin Emin E'min = Emin c for sawn lumber c for sawn lumber FcE FcE Cp Cp F'c = FcCFCp F'c = FcCFCp P ≥ C1 ∴ OK P ≥ C2 ∴ OK Fcp bearing from sill plate end ≥ 3''Fcp bearing from sill plate end ≥ 3'' Cb = (d₁ + 0.375'')/d₁Cb = (d₂ + 0.375'')/d₂ F'cp = FcpCb F'cp = FcpCb P ≥ C1 ∴ OK P ≥ C2 ∴ OK Holdown Anchors: z = 0.65 KFz t = 0.80 KFt Left side of shearwall Right side of shearwall (1)Simpson Holdown Anchor (1)Simpson Holdown Anchor CL db = 0'' dab CL db = 0'' dab Tallow Tallow T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK Ft F't = FtCF Ft F't = FtCF Anet1 Anet2 T1 ≥ T1 ∴ OK T2 ≥ T2 ∴ OK = 0.5'' = 2,461 lbs (160%) = 580,000 psi = 1.67 D. Fir-Larch = 580,000 psi = 580,000 psi = 1.5'' = 0.8 = 1,350 psi = 616 psi = cKFcF'cAC1 = 698 psi = 661 psi = 0.822Emin/(Kle/d)2 = 1,350 psi = 1.15 = 1,553 psi = 2.40 = nbd2 = zKFznhd(Tallow/1.6) = 6,165 lbs No. 2D. Fir-Larch = 0.397 = 616 psi = cKFcF'cAC2 = 6,990 lbs = 625 psi = 1.25 = cpKFcpF'cAC2 (160%) = 5.16 in² = tKFtF'tAnet2 = 575 psi = 781 psi= 781 psi = 580,000 psi = cpKFcpF'cAC1 = 0.8 = AC1 - d1(db+1/16'') = 0.5'' = 5.25 in² = 1,553 psi = 26.1 = 0.397 DTT2Z = 3.32 = 698 psi = 7,365 lbs= 7,365 lbs = 1.15 = 1.25 = nbd1 = 5.25 in² DTT2Z = 1,825 lbs = 0.8125'' = AC1 - d1(db+1/16'') = 1,825 lbs = 0.8125'' = zKFznhd(Tallow/1.6) = 6,990 lbs = 2,461 lbs = 2.70 No. 2 = 661 psi = 1.5'' = 0.822Emin/(Kle/d)2 = 6,165 lbs = 625 psi = tKFtF'tAnet1 = 5.16 in² = 575 psi ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 41 1123 S Magnolia Ave Unit# 22/19/2025 Deflection Cd = 4.5 deflection amplification factor Ie = 1.0 importance factor Risk Category I or II vmax using =1.0 Ga Case I: Shear Force Direction To The Right E1 a1 (no uplift) w = 8vmaxh3/E1AC1 + vmaxh/1000GaCub + ha1/Li x x < 2.0%OK Case II: Shear Force Direction To The Left E2 a2 (no uplift) w = 8vmaxh3/E2AC2 + vmaxh/1000GaCub + ha2/Li x x < 2.0%OK = 0.043'' + 0.075'' + 0'' = 0.118'' = 1,600,000 psi = Cdw/Ie = 0.531'' = (0.128'')T₂/øT₂ = Cdw/Ie = 0.531'' = 0.432% = 0.432% = 1,600,000 psi = x/H = x/H = 10 kip/in = (0.128'')T₁/øT₁ =V/nCubCARFLi = 0.0'' = 0.0'' = 0.043'' + 0.075'' + 0'' = 0.118'' = 89 plf ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 42 1123 S Magnolia Ave Unit# 22/19/2025 Seismic Reaction Forces With Overstrength Factor Fy anchor bolt yield strength = 2.5 = 1.0 0VE For bottom sill plate conection to rim joist/beam: V  maximum) T  maximum) For bottom sill plate conection to foundation: V  maximum) T  maximum) For holdown anchors: Case 1 - Seismic Load Direction To The Right = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCR MCR 1C2 eTR MTR = PTeTR - 1ME T1 Case 2 - Seismic Load Direction To The Left: = 2.5  maximum) PC PT = (0.9-0.2SDS)(PDL+wDLai)) - PE eCL MCL 2C1 eTL = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT MTL T2 (uplift)= MTL/(L-a1-dT2) - 2VEH/Cobi = -3,487 lbs = -3,487 lbs = 4,623 lbs = MCL/(L-a1-dT2) + 2VEH/Cobi = 4,594 lbs = PTeTL - 2ME = 2.5 = 411 lbs/bolt = 3.4 kip·ft = 3.4 kip·ft = 5.15 ft = 661 lbs = 5.15 ft = 5.15 ft = 8.1 kip·ft = 5.15 ft = 8.1 kip·ft= PC(L-a1-dT2-eCL) + 2ME = ((PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC = (PEai)+(wEai 2/2))+(1.2+0.2SDS)(PDLai)+wDLai 2/2))+f 1(PLLai)+(wDLai 2/2)) / PC (uplift) = 1.2Fydab 2/4T2 = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai))= 1,625 lbs (uplift) (uplift) = 2.5 = (TTE/ρ + PD)/nbolt = (TTE/ρ + PD)/nscrew = -582 lbs/screw = PE +(wEai)) + (1.2+0.2SDS)(PDL+wDLai)) + f 1(PLL+(wDLai)) = (-PEai)+(wEai 2/2))+(0.9-0.2SDS)(PDLai)+wDLai 2/2)) / PT = 1,625 lbs = MCR/(L-a1-dT2) + 1VEH/Cobi = MTR/(L-a2-dT1) - 1VEH/Cobi = ME + PC(L-a2-dT1-eCR) = -582 lbs/bolt = 1.2(0.6FyD2nscrew/4VE = 1,645 lbs = 661 lbs = 2.5 = 36 ksi = 1.2FyD2nscrew/4T VVE/nbolt TT/nbolt = 0.72Fydab 2nbolt/4VE = 1.2Fydab 2nbolt/4TE = 2.5 = 1.2Fydab 2/4T1 VVE/nscrew = 411 lbs/screw TT/nscrew ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 43 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:1/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 1.Project information Project description: Location: Fastening description: 2. Input Data & Anchor Parameters General Design method:ACI 318-14 Units: Imperial units Anchor Information: Anchor type: Cast-in-place Material: F1554 Grade 36 Diameter (inch): 0.375 Effective Embedment depth, hef (inch): 7.000 Anchor category: - Anchor ductility: Yes hmin (inch): 8.13 Cmin (inch): 2.25 Smin (inch): 2.25 Base Material Concrete: Normal-weight Concrete thickness, h (inch): 12.00 State: Cracked Compressive strength, f’c (psi): 2500 Ψc,V: 1.0 Reinforcement condition: A tension, A shear Supplemental edge reinforcement: Not applicable Reinforcement provided at corners: No Ignore concrete breakout in tension: No Ignore concrete breakout in shear: No Ignore 6do requirement: No Build-up grout pad: No Recommended Anchor Anchor Name: Heavy Hex Bolt - 3/8"Ø Heavy Hex Bolt, F1554 Gr. 36 Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 44 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:2/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 Load and Geometry Load factor source: ACI 318 Section 5.3 Load combination: not set Seismic design: No Anchors subjected to sustained tension: Not applicable Apply entire shear load at front row: No Anchors only resisting wind and/or seismic loads: No Strength level loads: Nua [lb]: 3300 Vuax [lb]: 0 Vuay [lb]: 0 <Figure 1> Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 45 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:3/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 <Figure 2> Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 46 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:4/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 3. Resulting Anchor Forces Anchor Tension load, Nua (lb) Shear load x, Vuax (lb) Shear load y, Vuay (lb) Shear load combined, √(Vuax)²+(Vuay)² (lb) 1 3300.0 0.0 0.0 0.0 Sum 3300.0 0.0 0.0 0.0 Maximum concrete compression strain (‰): 0.00 Maximum concrete compression stress (psi): 0 Resultant tension force (lb): 3300 Resultant compression force (lb): 0 Eccentricity of resultant tension forces in x-axis, e'Nx (inch): 0.00 Eccentricity of resultant tension forces in y-axis, e'Ny (inch): 0.00 4. Steel Strength of Anchor in Tension (Sec. 17.4.1) Nsa (lb)Nsa (lb) 4495 0.75 3371 5. Concrete Breakout Strength of Anchor in Tension (Sec. 17.4.2) Nb = kc a f’chef1.5 (Eq. 17.4.2.2a) kc a f’c (psi)hef (in)Nb (lb) 24.0 1.00 2500 6.500 19886 Ncb =(ANc / ANco)ed,N c,N cp,NNb (Sec. 17.3.1 & Eq. 17.4.2.1a) ANc (in2)ANco (in2)ca,min (in)ed,N c,N cp,N Nb (lb)Ncb (lb) 144.00 380.25 2.25 0.769 1.00 1.000 19886 0.75 4345 6. Pullout Strength of Anchor in Tension (Sec. 17.4.3) Npn =c,PNp =c,P8Abrgf’c (Sec. 17.3.1, Eq. 17.4.3.1 & 17.4.3.4) c,P Abrg (in2)f’c (psi)Npn (lb) 1.0 0.30 2500 0.70 4186 Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 47 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:5/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 7. Side-Face Blowout Strength of Anchor in Tension (Sec. 17.4.4) Nsb =(1+ca2/ca1)/4}(160ca1 Abrg)f’c (Sec. 17.3.1 & Eq. 17.4.4.1) ca1 (in)ca2 (in)Abrg (in2)a f’c (psi)Nsb (lb) 2.25 2.25 0.30 1.00 2500 0.75 3691 11. Results Interaction of Tensile and Shear Forces (Sec. 17.6) Tension Factored Load, Nua (lb)Design Strength, øNn (lb)Ratio Status Steel 3300 3371 0.98 Pass (Governs) Concrete breakout 3300 4345 0.76 Pass Pullout 3300 4186 0.79 Pass Side-face blowout 3300 3691 0.89 Pass 3/8"Ø Heavy Hex Bolt, F1554 Gr. 36 with hef = 7.000 inch meets the selected design criteria. 12. Warnings - Designer must exercise own judgement to determine if this design is suitable. Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 48 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:1/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 1.Project information Project description: Location: Fastening description: 2. Input Data & Anchor Parameters General Design method:ACI 318-14 Units: Imperial units Anchor Information: Anchor type: Bonded anchor Material: F1554 Grade 55 Diameter (inch): 0.375 Effective Embedment depth, hef (inch): 7.500 Code report: ICC-ES ESR-4057 Anchor category: - Anchor ductility: Yes hmin (inch): 8.75 cac (inch): 19.72 Cmin (inch): 1.75 Smin (inch): 1.00 Base Material Concrete: Normal-weight Concrete thickness, h (inch): 12.00 State: Cracked Compressive strength, f’c (psi): 3000 Ψc,V: 1.0 Reinforcement condition: A tension, A shear Supplemental edge reinforcement: Not applicable Reinforcement provided at corners: No Ignore concrete breakout in tension: No Ignore concrete breakout in shear: No Hole condition: Dry concrete Inspection: Continuous Temperature range, Short/Long: 150/110°F Reduced installation torque (for AT-3G): Not applicable Ignore 6do requirement: Not applicable Build-up grout pad: No Recommended Anchor Anchor Name: SET-3G™ - SET-3G w/ 3/8"Ø F1554 Gr. 55 Code Report: ICC-ES ESR-4057 Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 49 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:2/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 Load and Geometry Load factor source: ACI 318 Section 5.3 Load combination: not set Seismic design: No Anchors subjected to sustained tension: No Apply entire shear load at front row: No Anchors only resisting wind and/or seismic loads: No Strength level loads: Nua [lb]: 4100 Vuax [lb]: 0 Vuay [lb]: 0 <Figure 1> Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 50 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:3/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 <Figure 2> Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 51 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:4/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 3. Resulting Anchor Forces Anchor Tension load, Nua (lb) Shear load x, Vuax (lb) Shear load y, Vuay (lb) Shear load combined, √(Vuax)²+(Vuay)² (lb) 1 4100.0 0.0 0.0 0.0 Sum 4100.0 0.0 0.0 0.0 Maximum concrete compression strain (‰): 0.00 Maximum concrete compression stress (psi): 0 Resultant tension force (lb): 4100 Resultant compression force (lb): 0 Eccentricity of resultant tension forces in x-axis, e'Nx (inch): 0.00 Eccentricity of resultant tension forces in y-axis, e'Ny (inch): 0.00 4. Steel Strength of Anchor in Tension (Sec. 17.4.1) Nsa (lb)Nsa (lb) 5850 0.75 4388 5. Concrete Breakout Strength of Anchor in Tension (Sec. 17.4.2) Nb = kc a f’chef1.5 (Eq. 17.4.2.2a) kc a f’c (psi)hef (in)Nb (lb) 17.0 1.00 3000 6.833 16633 Ncb =(ANc / ANco)ed,N c,N cp,NNb (Sec. 17.3.1 & Eq. 17.4.2.1a) ANc (in2)ANco (in2)ca,min (in)ed,N c,N cp,N Nb (lb)Ncb (lb) 189.00 420.25 1.75 0.751 1.00 1.000 16633 0.75 4214 6. Adhesive Strength of Anchor in Tension (Sec. 17.4.5) k,cr =k,crfshort-termKsat(f’c /2,500)n k,cr (psi)fshort-term Ksat f’c (psi)n k,cr (psi) 1448 1.00 1.00 3000 0.24 1513 Nba =a cr dahef (Eq. 17.4.5.2) a cr (psi)da (in)hef (in)Nba (lb) 1.00 1513 0.38 7.500 13366 Na =(ANa / ANa0)ed,Na cp,NaNba (Sec. 17.3.1 & Eq. 17.4.5.1a) ANa (in2)ANa0 (in2)cNa (in)ca,min (in)ed,Na cp,Na Nba (lb)Na (lb) 79.48 120.53 5.49 1.75 0.796 1.000 13366 0.65 4558 Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 52 1123 S Magnolia Ave Unit# 22/19/2025 Company:Date:10/5/2022 Engineer:Page:5/5 Project: Address: Phone: E-mail: Anchor Designer™ Software Version 3.2.2311.2 11. Results Interaction of Tensile and Shear Forces (Sec. 17.6) Tension Factored Load, Nua (lb)Design Strength, øNn (lb)Ratio Status Steel 4100 4388 0.93 Pass Concrete breakout 4100 4214 0.97 Pass (Governs) Adhesive 4100 4558 0.90 Pass SET-3G w/ 3/8"Ø F1554 Gr. 55 with hef = 7.500 inch meets the selected design criteria. 12. Warnings - Designer must exercise own judgement to determine if this design is suitable. - Refer to manufacturer’s product literature for hole cleaning and installation instructions. Input data and results must be checked for agreement with the existing circumstances, the standards and guidelines must be checked for plausibility. Simpson Strong-Tie Company Inc.5956 W. Las Positas Boulevard Pleasanton, CA 94588 Phone: 925.560.9000 Fax: 925.847.3871 www.strongtie.com ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 53 1123 S Magnolia Ave Unit# 22/19/2025 INPUT DATA WALL LENGTH Lw =7 ft WALL HEIGHT h = 9.14583 ft WALL THICKNESS t = 5 in FOOTING LENGTH L = 18 ft L1 =11 ft FOOTING WIDTH B = 1 ft FOOTING THICKNESS T = 12 in FOOTING EMBEDMENT DEPTH D = 1 ft ALLOWABLE SOIL PRESSURE qa =1.50 ksf DEAD LOAD AT TOP WALL Pr,DL =0.0 kips LIVE LOAD AT TOP WALL Pr,LL =0.0 kips TOP LOAD LOCATION a = 3.5 ft WALL SELF WEIGHT Pw =0.2 kips LATERAL LOAD TYPE (0=wind,1=seismic)1 seismic SEISMIC LOAD (E/1.4 , ASD)F = 1.0 kips THE FOOTING DESIGN IS ADEQUATE. CONCRETE STRENGTH fc' =3 ksi REBAR YIELD STRESS fy =40 ksi TOP BARS, LONGITUDINAL 0 # 4 BOTTOM BARS, LONGITUDINAL 2 # 4 BOTTOM BARS, TRANSVERSE # 4 @ #DIV/0! in o.c.< == Not Required ANALYSIS CHECK OVERTURNING FACTOR (IBC 06 1605.2.1, 1801.2.1, & ASCE 7-05 12.13.4) F = MR / MO =2.65 >0.75 / (1.4 x 0.9) for seismic [Satisfactory] Where Pf =2.61 kips (footing self weight) MO = F (h + D) =10 ft-kips (overturning moment) MR = (Pr,DL) (L1 + a) + Pf (0.5 L) + Pw (L1 + 0.5Lw) =27 ft-kips (resisting moment without live load) CHECK SOIL CAPACITY (ALLOWABLE STRESS DESIGN) Ps =1.8 kips (soil weight in footing size) P = (Pr,DL + Pr,LL) + Pw + (Pf - Ps) =1.02 kips (total vertical net load) MR = (Pr,DL + Pr, LL) (L1 + a) + Pf (0.5 L) + Pw (L1 + 0.5Lw) =27 ft-kips (resisting moment with live load) e = 0.5 L - (MR - MO) / P =-7.16 ft (eccentricity from middle of footing) = -0.08 ksf <4 / 3 q a [Satisfactory] Where e = -7.16 ft, < (L / 6) CHECK FOOTING CAPACITY (STRENGTH DESIGN) Mu,R = 1.2 [Pr,DL (L1 + a) + Pf (0.5 L) + Pw (L1 + 0.5Lw)] + 0.5 Pr, LL(L1 + a) =32 ft-kips Mu,o =1.4 F(h + D) = 14 ft-kips Pu = 1.2 (Pr,DL + Pf + Pw ) + 0.5 Pr, LL =3 kips eu = 0.5L - (Mu,R - Mu,O) / Pu =3.74 ft 0.43 ksf Footing Design of Shear Wall Based on ACI 318-14 #N/A @6.'' O.C. ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 54 1123 S Magnolia Ave Unit# 22/19/2025 (cont'd) BENDING MOMENT & SHEAR AT EACH FOOTING SECTION Section 0 1/10 L 2/10 L 3/10 L 4/10 L 5/10 L 6/10 L 7/10 L 8/10 L 9/10 L L Xu (ft)0 1.80 3.60 5.40 7.20 9.00 10.80 12.60 14.40 16.20 18.00 Pu,w (klf)0.0 0.0 0.0 0.0 0.0 0.0 0.0 1.0 0.1 -0.8 -1.7 Mu,w (ft-k)0 0 0 0 0 0 0 -2 -7 -12 -15 Vu,w (kips)0 0 0 0 0 0 0 -2 -3 -2 0 Pu,f (ksf)0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 Mu,f (ft-k)0 0 -1 -3 -5 -7 -10 -14 -18 -23 -28 Vu,f (kips)0 0 -1 -1 -1 -2 -2 -2 -3 -3 -3 qu (ksf)-0.4 -0.4 -0.3 -0.3 -0.2 -0.2 -0.1 -0.1 0.0 0.0 0.0 Mu,q (ft-k)0 1 3 6 9 14 19 25 31 37 43 Vu,q (kips)0 1 1 2 2 3 3 3 3 3 3 Mu (ft-k)0 0 1 3 5 7 9 9 6 2 0 Vu (kips)0 0 1 1 1 1 1 -1 -2 -2 0 Location Mu,max d (in)reqD provD Vu,max Vc = 2 b d (fc')0.5 Top Longitudinal 0 ft-k 8.75 0.0000 0.0000 2 kips 10 kips Bottom Longitudinal 9 ft-k 8.75 0.0035 0.0038 2 kips 10 kips Bottom Transverse 0 ft-k / ft 8.25 0.0000 0.0000 0 kips / ft 9 kips / ft Where min =0.0014 0.0232 [Satisfactory] 0 2 4 6 8 10 Series1 -4 -2 0 2 Series1 ADU 1123 Magnolia Ave. Proj. No. 16113.00 09/30/24 55 1123 S Magnolia Ave Unit# 22/19/2025 SANTA ANA CITY COUNCIL Valerie Amezcua Mayor vamezcua@santa-ana.org Thai Viet Phan Mayor Pro Tem, Ward 1 tphan@santa-ana.org Benjamin Vazquez Ward 2 bvazquez@santa-ana.org Jessie Lopez Ward 3 jessielopez@santa-ana.org Phil Bacerra Ward 4 pbacerra@santa-ana.org Johnathan Ryan Hernandez Ward 5 jryanhernandez@santa-ana.org David Penaloza Ward 6 dpenaloza@santa-ana.org MAYOR Valerie Amezcua MAYOR PRO TEM Thai Viet Phan COUNCILMEMBERS Phil Bacerra Johnathan Ryan Hernandez Jessie Lopez David Penaloza Benjamin Vazquez CITY OF SANTA ANA Planning and Building Agency 20 Civic Center Plaza ● P.O. Box 1988 Santa Ana, California 92702 www.santa-ana.org ACTING CITY MANAGER Alvaro Nuñez CITY ATTORNEY Sonia R. Carvalho CLERK OF THE COUNCIL Jennifer L. Halll May 17, 2024 Also sent via email to: nancymarin47@yahoo.com Nancy Marin 1123 S. Magnolia Avenue Santa Ana, CA 92707 Subject: Address Assignment for a new Accessory Dwelling Unit (ADU) located at 1123 S. Magnolia Avenue and (APN: 013-012-28) in Santa Ana, CA Dear Ms. Marin, The City of Santa Ana Planning and Building Agency (PBA) is the responsible agency for legal addressing within the City of Santa Ana’s jurisdiction. This letter confirms the address assignment for a new ADU located at 1123 S. Magnolia Avenue and (APN: 013-012-28). Notice is hereby given that the following assigned address(es) shall be posted onsite per the approved address plan, attached hereto as Exhibit A. Address(es) to be Activated/Posted 1. 1123 S. Magnolia Avenue, Unit 2 (address for new ADU) To subdivide commercial and/or residential units into multiple units, a building permit (and all other associated permits), plans, and inspection approvals by the PBA are required. Address(es) will be verified during inspections by the Building Safety Division. Please update your records accordingly. Should you have any questions, feel free to contact me by phone at 714-667-2728 or by email at CSantana@santa-ana.org. Sincerely, Cristian Santana Cristian Santana Assistant Planner I Reviewed by: Jerry Guevara, Senior Planner Exhibit A – Address Plan 1123 S Magnolia Ave Unit# 22/19/2025 Address Letter for 1123 S. Magnolia Avenue Page 2 of 2 c: Vencent Quaglia, United States Post Office Chris Tuiolosega, United States Post Office Cipriano Corona, Marketing Manager, United States Post Office Alex Alvarez, Postmaster Santa Ana, United States Post Office Federal Express, Administration Cathy Joseph, Garden Grove Unified School District Christine Hy, Garden Grove Unified School District Cathy Slader, Orange Unified School District Orin Williams, Santa Ana Unified School District Yvette Miranda, Santa Ana Unified School District Cristina Bernal, Tustin Unified School District Mishele Richards, Orange County Fire Authority, GEO Files Coordinator Orange County Fire Authority Neal Kelly, Registrar of Voters Members, Board of Supervisors Southern California Gas Company Southern California Edison Company Claude Parrish, County Assessor's Office SAG, AT&T UPS, Administration City Manager’s Office Beverly Martin, Police Community Services Specialist Boris Duran, Police Systems Manager Jennifer Mendoza, Police Communications Manager Chris Hubbard, Police Systems Support Analyst Will Holt, Treasury & Customer Services Manager Hector Jimenez, Revenue Supervisor Mirella Vargas, Customer Service Representative Judson Brown, Housing & Neighborhood Development Manager Rudy Rosas, Principal Civil Engineer Zdenek (Zed) Kekula, Principal Civil Engineer Jason Kwak, Building Safety Manager Evelyn LaRocca, Permit Supervisor Kathy Hernandez, Permit Technician Julie Amsden, Permit Technician Ali Pezeshkpour, Planning Manager Jerry Guevara, Senior Planner Alvaro Nunez, PBA Assistant Director and Code Enforcement Manager 1123 S Magnolia Ave Unit# 22/19/2025 LCMAGNOLIA PL PLPL PL (E)GRASS (E) CONCRETE PATIO (E) MAIN STRUCTURE 1364 SQFT (E) DRIVE WAY (E) FRONT YARD (E) STORAGE SHED 90 SQFT WH (N) UNIT 2 510 SQFT This drawings,specifications and ideas, with these drawings shall constitute evidence Disclaimer FRONT PAGE PLOT PLAN VICINITY MAP SHEET TITLE REVISIONS designs thereby are and shall remain the property of F. SOLIS (Designer) and no part thereof shall be copied disclosed to others or used in connection with any work or project for which there have been prepared and developed,without the the written consent of F.SOLIS,visual contact of acceptance of these restrictions. Sheet A-1 VICINITY MAP PROJECT LOCATION PROJECT SITE DATA DESCRIPTION: 0 S.FT. ADU. (R-) TYPE OF CONSTRUCTION: V-B ONING : RSFR BUILDING SPRINKLERS : NO ADU TO MATCH BUILDING SUARE FOOTAGE: LOT AREA : /- .2 AC. NEW ADDITION : 00 S.FT. ASSESSORS PARCEL NO.: 0-02-2 LOT NUMBER - 20 / B INDEX SHEET TITLE PLANNING SET FRONT PAGE, PROPOSED PLOT PLAN, VICINITY MAP GENERAL NOTES PROPOSED ADU FLOOR PLAN. DEMO FLOOR PLAN EXISTING ROOF PLAN ELEVATIONS. FRAMING / FOUNDATION PLAN DETAILS TITLE 2 TITLE 2 TITLE 2 CALIFORNIA GREEN SHEET CALIFORNIA GREEN SHEET A- A-2 A-2. A-2.2 A- A- S- S-2 T- T-2 T- G- G-2 PROJECT CODE REUIREMENTS LEGAL JURISDICTION: CITY OF SANTA ANA THE DESIGN AND CONSTRUCTION OF THIS STRUCTURE SHALL BE IN FULL COMPLIANCE WITH 2022 CALIFORNIA BUILDING CODE WITH ORANGE COUNTY AMENDMENTS 2022 CALIFORNIA RESIDENTIAL CODE 2022 CALIFORNIA MECHANICAL CODE 2022 CALIFORNIA ELECTRICAL CODE 2022 CALIFORNIA PLUMBING CODE 2022 CALIFORNIA ENERGY CODE 2022 ORANGE COUNTY FIRE CODE 2022 ORANGE COUNTY GREEN BUILDING STANDARDS CODE 2022 CFC 2022 OC CO PC NEW ADU CONVERTION EXISTING STRUCTURE PROPERTY OWNER INFORMATION SCOPE OF WORK: -DEMO EXISTING GARAGE DOOR -NEW BATHROOM -NEW KITCHEN/LIVING AREA -NEW STUCCO TO MATCH EXISTING -NEW WINDOWS/DOORS SC A L E NO T T O 0 8' 16' 24' Scale: 3/32" = 1'-0" (E) LANDSCAPE (E) PAVED DRIVEWAY / WALKWAY . LOT AREA -,00.00 SFT. 2. EXISTING HOUSE AREA - ,.00 SFT . (E) GARAGE - 0.0 SFT . PROPOSED ADU -0.0 SFT . TOTAL COVER AREA - ,.0 SFT . COVER AREA -2.0 . OPEN AREA -. SUMMARY NANCY MARIN () 20- AD U 11 2 3 M A G N O L I A A V E U N I T # 3 , SA N T A A N , C A , 9 2 7 0 7 PATH OF TRAVEL 1 PLAN CHECK 08.29.23NOTES: DIG ALERT () IS TO BE CONTACTED AND COMPLIANCE WITH EXCAVATION SAFETY IN ACCORDANCE WITH GOVERNMENT CODE 2 PRIOR TO ANY EXCAVATION TAKING PLACE.Exhibit A 1123 S Magnolia Ave Unit# 22/19/2025