Loading...
HomeMy WebLinkAboutHOLD - 1001 N Van Ness Ave - Plan6' - 6 " 16'-0" 1 2 3 4 4 4 5 7 6' - 6 " 16'-0" 1 2 2 3 REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 D E S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 T-1 DESIGN TEAM VICINITY MAP PROJECT SUMMARY ASSESSOR'S MAP PROJECT NAME: LOCATION: OCCUPANCY GROUP: CONSTRUCTION TYPE: NUMBER OF STORIES: PARCEL NUMBER: BALCONY REPAIR 1001 N. VAN NESS SANTA ANA, CALIFORNIA 92701 R-2 (MULTI-FAMILY RESIDENTIAL) V-B 2 398-535-04 1. THE GENERAL CONTRACTOR SHALL HAVE WORKMAN'S COMPENSATION FOR ALL PERSONS WORKING ON THE JOB. 2. THE GENERAL CONTRACTOR SHALL PROVIDE LIEN RELEASES FOR ALL LABOR AND MATERIALS PAID FOR PRIOR TO RECEIVING THE NEXT INSTALLATION PAYMENT. 3. ALL WORK SHALL CONFORM TO THE CODES, REGULATION AND STANDARDS OF THE GOVERNING CITY, COUNTY AND STATE AGENCIES. 4. ALL MATERIALS SHALL BE PREMIUM GRADE QUALITY THROUGHOUT. NO SUBSTITUTION OF SPECIFIED MATERIALS ALLOWED WITHOUT CONSENT FROM THE ARCHITECT. 5. THE GENERAL CONTRACTOR SHALL REPAIR OR REPLACE ANY ITEM DAMAGED DURING THE COURSE OF CONSTRUCTION BY HIS EMPLOYEES OR SUBCONTRACTORS. 6. GENERAL CONTRACTOR SHALL HAVE THE ENTIRE SCOPE OF WORK AREA PROFESSIONALLY CLEANED, INCLUDING ALL WINDOWS AND DOORS INSIDE AND OUTSIDE. 7. WHERE NO SPECIFIC DETAIL IS SHOWN, THE CONSTRUCTION SHALL BE SIMILAR TO THAT INDICATED OR NOTED FOR SIMILAR CONDITIONS. WHERE CONFLICTING MATERIALS AND CONDITIONS ARE CALLED OUT, ASSUME THE MORE EXPENSIVE CONDITION. NOTIFY THE OWNER AND ARCHITECT PRIOR TO WORK BEING STARTED. GENERAL NOTES SCOPE OF WORK THE FOLLOWING ARE THE SCOPE OF WORK: 1. REPAIR BALCONY AS REQUIRED BY SB721 · SEVERE LEVEL JOIST/RIM JOIST/BEAM AND LEDGER DEFECT - SEVERE DAMAGE TO WOOD FRAME COMPONENTS, PARTICULARLY THE JOISTS AND RIM JOISTS INCLUDES EXTENSIVE STRUCTURAL COMPROMISE, VISIBLE SIGNS OF ROT, SUBSTANTIAL CRACKS AND POTENTIAL LOAD-BEARING CONCERNS. · CRACKS IN THE COVE JOINT WHERE THE SURFACE MEETS THE GUARDRAIL OR WALL. · DECKING/SHEATHING SHOWS MODERATE SIGNS OF DAMAGE INCLUDING WATER INTRUSING/ LOCALIZED SOFTENING AND POTENTIAL DELAMINATION. SLIGHT SAGGING/WARPING DRAWING INDEX T-1 TITLE SHEET & SITE PLAN A-1 EXISTING AND PROPOSED FLOOR PLANS & ELEVATION A-2 EXISTING AND PROPOSED SECTION & DETAILS CALG-1 CALGREEN SHEET CALG-2 CALGREEN SHEET S-0 STRUCTURAL GENERAL NOTES S-1 FOUNDATION & FRAMING PLANS BALCONY REPAIR FOR UNIT I 1001 N. VAN NESS, SANTA ANA, CA 92701 SITE KEYNOTES SITE PHOTOGRAPH 1. REPAIR BALCONY AT UNIT I - SCOPE OF WORK AREA 2. WALKWAY CRACKS TO BE REPAIRED BY APPROVED CRACK SEALANT SIKAFLEX 'CONCRETE FIX'. CRACKS IN THE COVE JOINT WHERE THE SURFACE MEETS THE GUARDRAIL OR WALL. 3. AREA OF REPAIR OF DAMAGED BALCONY 4. LANDSCAPE 5. CONCRETE DRIVEWAY 6. BALCONY DRAIN LOCATION TI T L E S H E E T & S I T E P L A N BUILDING CODE: 2022 CBC 2022 CRC 2022 CEC 2022 CMC 2022 CPC 2022 CA GREEN BUILDING STANDARDS CODE (CG) 2022 TITLE 24 ENERGY STANDARDS AND ALL APPLICABLE CITY OF SANTA ANA AND ORANGE COUNTY MUNICIPAL CODES AND COUNTY AMENDMENTS ARCHITECT: DESIGN CONCEPTS SHIV TALWAR, AIA 3304 RIVERSIDE DRIVE #M CHINO, CA 91719 TEL: (909)591-3939 designconcepts@yahoo.com STRUCTURAL ENGINEERING: DESIGN CONCEPTS SHIV TALWAR, AIA 3304 RIVERSIDE DRIVE #M CHINO, CA 91719 TEL: (909)591-3939 designconcepts@yahoo.com OWNER: MR. PAUL THAKUR 23 DAYBREAK IRVINE, CA 92614 MR. (949)677-2478 jpthakur@hotmail.com 10TH EXISTING SITE PLAN 1SCALE: NTS EXISTING 2-STORY APARTMENT BUILDING NOTE: PROVIDE STRUCTURAL OBSERVATION REPORT DURING CONSTRUCTION. LEGEND EXISTING STRUCTURE PROPERTY LINE WALKWAY BUILDING SETBACK LINE PROPOSED REPAIR CENTER LINE ACCESSIBILITY PATH OF TRAVEL LANDSCAPE DRIVEWAY LP ENLARGED SITE PLAN Bldg #104121580 APPROVALS: PLNG - C. Santana BLDG - K. Ahangian HOLD - 1001 N Van Ness Ave3/7/2025 16'-0" 5'-3"10'-0"9" 2' - 6 " 1' - 6 " 2' - 6 " LIVING PATIO ENTRANCE 6' - 6 " 1 2 4 A-2 AA 1 2 A C B 4' - 0 " 5'-11"6'-4"3'-3" 16'-6" BALCONY LIVING 3 56 SQ. FT. A-2 AA 2 A-2 1 A-2 5 1 2 A C B 3 A-2 3 FIRST FL. F.F. 0'-6" C.M.U. WALL APPROX. 4'-0" FIRST FL. CLG. 8'-6" SECOND FL. F.F. 9'-6" 1 2 (E ) 3 ' - 0 " (P ) 3 ' - 6 " AA A-2 UNIT #I BALCONY 6 REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 DE S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 EX I S T I N G A N D P R O P O S E D A-1EXISTING AND PROPOSED FIRST FLOOR PLAN (PARTIAL) - UNIT I SCALE: 1/2"= 1'-0" EXISTING AND PROPOSED SECOND FLOOR PLAN (PARTIAL) - UNIT I SCALE: 1/2"= 1'-0" KEYNOTES 1.LINE OF SECOND FLOOR. 2.LINE OF BALCONY AT SECOND FLOOR. 3.EXISTING GUARDRAIL. 4.EXISTING CMU WALL. 5.LINE OF FIRST FLOOR. 6.REMOVE AND REPLACE EXTERIOR PLASTER AS NECESSARY FOR THE REPAIR OF THE BALCONY GUARDRAIL. PRPOSED REPAIR TO MATCH EXISTING ADJACENT BALCONIES. 7.BALCONY DRAIN SEE DETAIL 3/A-2. EXISTING AND PROPOSED ELEVATION (PARTIAL)SCALE: 1/2"= 1'-0" GENERAL NOTES 1.GUARDS SHALL NOT HAVE OPENINGS FROM THE WALKING SURFACE TO THE REQUIRED GUARD HEIGHT THAT ALLOW PASSAGE OF A SPHERE 4 INCHES IN DIAMETER. [R312.1.3] 2.THE CLEAR WIDTH AT A ND BELOW THE HANDRAILS AT SPIRAL STAIRWAYS CANNOT BE LESS THAN 26 INCHES AND THE WALKLINE RADIUS CANNOT BE GREATER THAN 24 -1/2 INCHES. E ACH TREAD MUST HAVE A DEPTH OF NOT LESS THAN 6-3/4 INCHES AT THE WALKLINE. T READS MUST BE IDENTICAL, AND THE RISE CANNOT BE MORE THAN 9-1/2 INCHES. HEADROOM CANNOT BE LESS THAN 6 FEET 6 INCHES. [R311.7.10.1 3.GUARDS AT OPEN-SIDED WALKING SURFACES, INCLUDING STAIRS, PORCHES, BALCONIES OR LANDINGS, MUST BE NOT LESS THAN 42 INCHES IN HEIGHT AS MEASURED VERTICALLY ABOVE THE ADJACENT WALKING SURFACES OR THE LINE CONNECTING THE NOSINGS. [R312.1.2] 2.WHERE BALCONIES OR OTHER ELEVATED WALKING SURFACES ARE EXPOSED TO WATER FROM DIRECT OR BLOWING RAIN, SNOW, OR IRRIGATION, AND THE STRUCTURAL FRAMING IS PROTECTED BY AN IMPERVIOUS MOISTURE BARRIER, THE CONSTRUCTION DOCUMENTS MUST INCLUDE DETAILS FOR ALL ELEMENTS OF THE IMPERVIOUS MOISTURE BARRIER SYSTEM. THE CONSTRUCTION DOCUMENTS MUST INCLUDE MANUFACTURER'S INSTALLATION INSTRUCTIONS. [R106.1.5]. 1 2 3 FL O O R P L A N S & E L E V A T I O N S (E)EXISITING (P)PROPOSED F.F.FINISHED FLOOR FL.FLOOR CLG.CEILING C.M.U.CONCRETE MASONRY UNIT LEGEND HOLD - 1001 N Van Ness Ave3/7/2025 NOTES FOR ADDITIONAL REQUIRED INFORMATION CONCRETE SUBSTRATES SHEET METAL INSTALLATION - CONCRETE SHEET METAL INSTALLATION - WOOD REFER TO THE FOLLOWING INSTALLATION PLYWOOD SHEATHING AND FRAMING 3B. 2. 1. 3A. SMOOTHING COAT DEX-O-TEX ELASTATEX 500 DETAIL COAT WITH FABRIC REINFORCEMENT AT SHEET METAL INTERFACE WITH BUILDING PAPER IN BEHIND FLANGE AT SIDES AND BOTTOM, SHINGLE FASHION SELF-ADHERING SHEET MEMBRANE AT TOP OVER FLANGE SHEET MEMBRANE SELF-ADHERING SEALANT BETWEEN OUTER FLANGE AND SCUPPER SELF-ADHERING SHEET MEMBRANE OVER FLANGE AT TOP BUILDING PAPER BUILDING PAPER (E) WOOD FRAMING WALL 3" (E) PLYWOOD SUB-FLOOR - REPLACE SILICONE SEALANT DEX-O-TEX OR EQUAL SLIP SHEET WATERPROOF MEMBRANE SYSTEM "DEX-O-TEX WEATHERWEAR" L FLASHING (E) STUD WALL PLYWOOD (E) STUCCO 26 GAGE6" SILICONE SEALANT Z FLASHING 26 GAGE ROLLED EDGE PRIMED & PAINTED TO MATCH WALL 4" 1/4" :12 SLOPE TO DRAIN MANUF'R: DEX-O-TEX (WEATHERWEAR) ICC #: ESR - 1757 INSTALL PER MANUFACTURER'S RECOMMENDATION. (E) FLOOR FINISH (E) FLOOR FRAMING (E) FLOOR FRAMING BALCONY BEDROOM LIVING FIRST FL. F.F. 0'-0" FIRST FL. CLG. 8'-0" SECOND FL. F.F. 9'-0" (E ) 3 ' - 0 " (P ) 3 ' - 6 " 4 S-1 1 2 3 4 3 S-1 5 PATIO 1 A-2 1/4" :12 SLOPE TO DRAIN SLIDING GLASS DOORS VERIFY PROFILE & ANCHORAGE W/ MANUFACTURER SILICONE SEAL SCREWS OR NAILS THAT PENETRATE FLASHING (E) FLOOR FINISH WOOD BASE TRIM (E) PLYWOOD SUB-FLOOR - REPLACE DEX-O-TEX OR EQUAL SLIP SHEET WATERPROOF MEMBRANE SYSTEM "DEX-O-TEX WEATHERWEAR" L FLASHING 26 GAGE 6" 1/2" VERIFY SIZE MANUF'R: DEX-O-TEX (WEATHERWEAR) ICC #: ESR - 1757 INSTALL PER MANUFACTURER'S RECOMMENDATION. (E) FLOOR FRAMING (E) FLOOR FRAMING MAXIMUM 1.5" THRESHOLD AT DECK/HOUSE REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 DE S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 EX I S T I N G A N D P R O P O S E D A-2 1. GYP. BOARD AT WALL AND CEILING. 2. WATERPROOF MEMBRANE SYSTEM. 3. PROPOSED GUARDRAIL. 4. SLIDING BALCONY DOOR. 5. EXISTING EXTERIOR PLASTER. EXISTING AND PROPOSED SECTION AA (PARTIAL) DECK TO WALL DETAIL SCALE: NTS SECTION KEYNOTES 1 1 SE C T I O N & D E T A I L S 2 GENERAL NOTES 1. GUARDRAIL SHALL NOT HAVE OPENINGS FROM THE WALKING SURFACE TO THE REQUIRED GUARDRAIL HEIGHT THAT ALLOW PASSAGE OF A SPHERE 4 INCHES IN DIAMETER. [R312.1.3] 2. THE CLEAR WIDTH AT A ND BELOW THE HANDRAILS AT SPIRAL STAIRWAYS CANNOT BE LESS THAN 26 INCHES AND THE WALKLINE RADIUS CANNOT BE GREATER THAN 24 -1/2 INCHES. EACH TREAD MUST HAVE A DEPTH OF NOT LESS THAN 6-3/4 INCHES AT THE WALKLINE. T READS MUST BE IDENTICAL, AND THE RISE CANNOT BE MORE THAN 9-1/2 INCHES. HEADROOM CANNOT BE LESS THAN 6 FEET 6 INCHES. [R311.7.10.1 3. GUARDS AT OPEN-SIDED WALKING SURFACES, INCLUDING STAIRS, PORCHES, BALCONIES OR LANDINGS, MUST BE NOT LESS THAN 42 INCHES IN HEIGHT AS MEASURED VERTICALLY ABOVE THE ADJACENT WALKING SURFACES OR THE LINE CONNECTING THE NOSINGS. [R312.1.2] 2. WHERE BALCONIES OR OTHER ELEVATED WALKING SURFACES ARE EXPOSED TO WATER FROM DIRECT OR BLOWING RAIN, SNOW, OR IRRIGATION, AND THE STRUCTURAL FRAMING IS PROTECTED BY AN IMPERVIOUS MOISTURE BARRIER, THE CONSTRUCTION DOCUMENTS MUST INCLUDE DETAILS FOR ALL ELEMENTS OF THE IMPERVIOUS MOISTURE BARRIER SYSTEM. THE CONSTRUCTION DOCUMENTS MUST INCLUDE MANUFACTURER'S INSTALLATION INSTRUCTIONS. [R106.1.5]. SCALE: 1/2"= 1'-0" SCALE: NTS DECK TO DOOR DETAIL (E)EXISITING (P)PROPOSED F.F.FINISHED FLOOR FL.FLOOR CLG.CEILING C.M.U. CONCRETE MASONRY UNIT LEGEND SCALE: NTS 3 BALCONY DRAIN DETAIL Provide primary and secondary drainage, Inspector Please Verify HOLD - 1001 N Van Ness Ave3/7/2025 REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 DE S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 S-0 NAILING SCHEDULES FOUNDATION & FRAMING GENERAL NOTES 1. HOLDOWN HARDWARE MUST BE SECURED IN PLACE PRIOR TO FOUNDATION INSPECTION. 2. PLATE WASHERS AND HOLDOWN SHALL BE TIGHTENED JUST PRIOR TO COVERING THE WALL FRAMING. 3. ONLY COMMON NAILS SHALL BE USED FOR ALL PLYWOOD SHEARWALLS AND DIAPHRAGMS. 4. ALL BOLT HOLES SHALL BE DRILLED 1/32" OR 1/16" OVERSIZED. 5. ALL FOUNDATION EXCAVATIONS MUST BE OBSERVED BY THE PROJECT ENGINEER GEOLOGIST AND OR/ PROJECT GEOTECHNICAL ENGINEER PRIOR TO PLACEMENT OF REINFORCING STEEL. 6. FOUNDATION SUPPORTING WOOD SHALL BE 6" MIN. ABOVE ADJACENT FINISH GRADE/ SURFACE. 7. STUDS IN EXTERIOR WALLS OR INTERIOR BEARING PARTITIONS SHALL BE CUT OR NOTCHED NO MORE THAN 25% OF THE WIDTH. INTERIOR NON- BEARING PARTITIONS MAY BE NOTCHED 40% OF THE WIDTH - CBC 2320.11.9. 8. BORED HOLES IN ANY STUD SHALL BE LIMITED TO 40% OF THEIR WIDTH AND SHALL BE LOCATED AT LEAST 5/8" FROM THE EDGE OF THE STUD - CBC 2320.11.10. 9. NAILING FOR DIAPHRAMS AND FOR ALL SHEARWALLS SHALL BE INSPECTED PRIOR TO COVERING. 10. SHEARWALLS SHALL RUN CONTINUOUSLY FROM FOUNDATION TO ROOF / FLOOR FRAMING. 11. PLYWOOD SHALL HAVE FRAMING OR BLOCKING AT ALL EDGES OF ALL SHEETS IN SHEARWALLS - CBC 2315.5. 12. STUDS SUPPORTING TWO OR MORE FLOORS AND A ROOF SHALL BE 2x6 OR 3x4. 13. ALL MASONRY WALL ANCHOR BOLT EMBEDMENT SHALL BE PER DETAIL. 14. USE 2 x STUDS @ ALL JOINTS @ EDGES, STAGGERED NAILING EACH SIDE OF JOINTS. 15. USE 2 x SILL PLATES 16. ALL SILL PLATES SHALL BE PRE-DRILLED. 17. ALL NAILS SHALL BE COMMON NAILS AND STAGGERED NAILS IF NAIL SPACING IS LESS THAN 2" O.C. 18. SQUARE PLATE WASHERS SHALL BE USE WITH ALL ANCHOR BOLTS AND HOLDOWN BOLTS. 19. PLATE WASHER SIZE SHALL BE 3" x 3" x 0.229" CBC 23.08.12.8. 20. FASTENERS FOR PRESERVATIVE-TREATED AND FIRE-RETARDANT- TREATED WOOD SHOULD BE OF HOT-DIPPED ZINC COATED GALVANIZED STEEL, STAINLESS STEEL, SILICON BRONZE, OR COPPER. THE COATING WEIGHTS FOR ZINC-COATED FASTENERS SHALL BE ACCORDANCE WITH ASTM A 153. FASTENINGS FOR WOOD FOUNDATIONS SHOULD BE AS REQUIRED IN AF&PA TECHNICAL REPORT NO.7. REVISE SPECIFICATION FOR NAILS AND SCREWS ACCORDINGLY. [CBC 2304.9.5]. ST R U C T U R A L G E N E R A L N O T E S HOLD - 1001 N Van Ness Ave3/7/2025 HOLD - 1001 N Van Ness Ave3/7/2025 CHAPTER 4 RESIDENTIAL MANDATORY MEASURES DIVISION 4.1 PLANNING AND DESIGN DIVISION 4.3 WATER EFFICIENCY AND CONSERVATION 4.406 ENHANCED DURABILITY AND REDUCED MAINTENANCE 4.406.1 RODENT PROOFING. Annular spaces around pipes, electric cables, conduits or other openings in sole/bottom plates at exterior walls shall be protected against the passage of rodents by closing such openings with cement mortar, concrete masonry or a similar method acceptable to the enforcing agency. 4.408 CONSTRUCTION WASTE REDUCTION, DISPOSAL AND RECYCLING 4.408.1 CONSTRUCTION WASTE MANAGEMENT. Recycle and/or salvage for reuse a minimum of 65 percent of the non-hazardous construction and demolition waste in accordance with either Section 4.408.2, 4.408.3 or 4.408.4, or meet a more stringent local construction and demolition waste management ordinance. Exceptions: 1. Excavated soil and land-clearing debris. 2. Alternate waste reduction methods developed by working with local agencies if diversion or recycle facilities capable of compliance with this item do not exist or are not located reasonably close to the jobsite. 3. The enforcing agency may make exceptions to the requirements of this section when isolated jobsites are located in areas beyond the haul boundaries of the diversion facility. 4.408.2 CONSTRUCTION WASTE MANAGEMENT PLAN. Submit a construction waste management plan in conformance with Items 1 through 5. The construction waste management plan shall be updated as necessary and shall be available during construction for examination by the enforcing agency. 1. Identify the construction and demolition waste materials to be diverted from disposal by recycling, reuse on the project or salvage for future use or sale. 2. Specify if construction and demolition waste materials will be sorted on-site (source separated) or bulk mixed (single stream). 3. Identify diversion facilities where the construction and demolition waste material collected will be taken. 4. Identify construction methods employed to reduce the amount of construction and demolition waste generated. 5. Specify that the amount of construction and demolition waste materials diverted shall be calculated by weight or volume, but not by both. 4.408.3 WASTE MANAGEMENT COMPANY. Utilize a waste management company, approved by the enforcing agency, which can provide verifiable documentation that the percentage of construction and demolition waste material diverted from the landfill complies with Section 4.408.1. Note: The owner or contractor may make the determination if the construction and demolition waste materials will be diverted by a waste management company. 4.408.4 WASTE STREAM REDUCTION ALTERNATIVE [LR]. Projects that generate a total combined weight of construction and demolition waste disposed of in landfills, which do not exceed 3.4 lbs./sq.ft. of the building area shall meet the minimum 65% construction waste reduction requirement in Section 4.408.1 4.408.4.1 WASTE STREAM REDUCTION ALTERNATIVE. Projects that generate a total combined weight of construction and demolition waste disposed of in landfills, which do not exceed 2 pounds per square foot of the building area, shall meet the minimum 65% construction waste reduction requirement in Section 4.408.1 4.408.5 DOCUMENTATION. Documentation shall be provided to the enforcing agency which demonstrates compliance with Section 4.408.2, items 1 through 5, Section 4.408.3 or Section 4.408.4.. Notes: 1. Sample forms found in "A Guide to the California Green Building Standards Code (Residential)" located at www.hcd.ca.gov/CALGreen.html may be used to assist in documenting compliance with this section. 2. Mixed construction and demolition debris (C & D) processors can be located at the California Department of Resources Recycling and Recovery (CalRecycle). 4.410 BUILDING MAINTENANCE AND OPERATION 4.410.1 OPERATION AND MAINTENANCE MANUAL. At the time of final inspection, a manual, compact disc, web-based reference or other media acceptable to the enforcing agency which includes all of the following shall be placed in the building: 1. Directions to the owner or occupant that the manual shall remain with the building throughout the life cycle of the structure. 2. Operation and maintenance instructions for the following: a. Equipment and appliances, including water-saving devices and systems, HVAC systems, photovoltaic systems, electric vehicle chargers, water-heating systems and other major appliances and equipment. b. Roof and yard drainage, including gutters and downspouts. c. Space conditioning systems, including condensers and air filters. d. Landscape irrigation systems. e. Water reuse systems. 3. Information from local utility, water and waste recovery providers on methods to further reduce resource consumption, including recycle programs and locations. 4. Public transportation and/or carpool options available in the area. 5. Educational material on the positive impacts of an interior relative humidity between 30-60 percent and what methods an occupant may use to maintain the relative humidity level in that range. 6. Information about water-conserving landscape and irrigation design and controllers which conserve water. 7. Instructions for maintaining gutters and downspouts and the importance of diverting water at least 5 feet away from the foundation. 8. Information on required routine maintenance measures, including, but not limited to, caulking, painting, grading around the building, etc. 9. Information about state solar energy and incentive programs available. 10. A copy of all special inspections verifications required by the enforcing agency or this code. 11. Information from CAL Fire on maintenance of defensible space around residential structures. 4.410.2 RECYCLING BY OCCUPANTS. Where 5 or more multifamily dwelling units are constructed on a building site, provide readily accessible area(s) that serves all buildings on the site and are identified for the depositing, storage and collection of non-hazardous materials for recycling, including (at a minimum) paper, corrugated cardboard, glass, plastics, organic waster, and metals, or meet a lawfully enacted local recycling ordinance, if more restrictive. Exception: Rural jurisdictions that meet and apply for the exemption in Public Resources Code Section 42649.82 (a)(2)(A) et seq. are note required to comply with the organic waste portion of this section. DIVISION 4.4 MATERIAL CONSERVATION AND RESOURCE EFFICIENCY DIVISION 4.5 ENVIRONMENTAL QUALITY 4.303 INDOOR WATER USE 4.303.1 WATER CONSERVING PLUMBING FIXTURES AND FITTINGS. Plumbing fixtures (water closets and urinals) and fittings (faucets and showerheads) shall comply with the sections 4.303.1.1, 4.303.1.2, 4.303.1.3, and 4.303.4.4. Note: All noncompliant plumbing fixtures in any residential real property shall be replaced with water-conserving plumbing fixtures. Plumbing fixture replacement is required prior to issuance of a certificate of final completion, certificate of occupancy, or final permit approval by the local building department. See Civil Code Section 1101.1, et seq., for the definition of a noncompliant plumbing fixture, types of residential buildings affected and other important enactment dates. 4.303.1.1 Water Closets. The effective flush volume of all water closets shall not exceed 1.28 gallons per flush. Tank-type water closets shall be certified to the performance criteria of the U.S. EPA WaterSense Specification for Tank-type Toilets. Note: The effective flush volume of dual flush toilets is defined as the composite, average flush volume of two reduced flushes and one full flush. 4.303.1.2 Urinals. The effective flush volume of wall mounted urinals shall not exceed 0.125 gallons per flush. The effective flush volume of all other urinals shall not exceed 0.5 gallons per flush. 4.303.1.3 Showerheads. 4.303.1.3.1 Single Showerhead. Showerheads shall have a maximum flow rate of not more than 1.8 gallons per minute at 80 psi. Showerheads shall be certified to the performance criteria of the U.S. EPA WaterSense Specification for Showerheads. 4.303.1.3.2 Multiple showerheads serving one shower. When a shower is served by more than one showerhead, the combined flow rate of all the showerheads and/or other shower outlets controlled by a single valve shall not exceed 1.8 gallons per minute at 80 psi, or the shower shall be designed to only allow one shower outlet to be in operation at a time. Note: A hand-held shower shall be considered a showerhead. 4.303.1.4 Faucets. 4.303.1.4.1 Residential Lavatory Faucets. The maximum flow rate of residential lavatory faucets shall not exceed 1.2 gallons per minute at 60 psi. The minimum flow rate of residential lavatory faucets shall not be less than 0.8 gallons per minute at 20 psi. 4.303.1.4.2 Lavatory Faucets in Common and Public Use Areas. The maximum flow rate of lavatory faucets installed in common and public use areas (outside of dwellings or sleeping units) in residential buildings shall not exceed 0.5 gallons per minute at 60 psi. 4.303.1.4.3 Metering Faucets. Metering faucets when installed in residential buildings shall not deliver more than 0.2 gallons per cycle. 4.303.1.4.4 Kitchen Faucets. The maximum flow rate of kitchen faucets shall not exceed 1.8 gallons per minute at 60 psi. Kitchen faucets may temporarily increase the flow above the maximum rate, but not to exceed 2.2 gallons per minute at 60 psi, and must default to a maximum flow rate of 1.8 gallons per minute at 60 psi. Note: Where complying faucets are unavailable, aerators or other means may be used to achieve reduction. 4.303.1.4.5 Pre-rinse spray valves. When installed, shall meet the requirements in the California Code of Regulations, Title 20 (Appliance Efficiency Regulations), Sections 1605.1 (h)(4) Table H-2, Section 1605.3 (h)(4)(A), and Section 1607 (d)(7) and shall be equipped with an integral automatic shutoff. FOR REFERENCE ONLY: The following table and code section have been reprinted from the California Code of Regulations, Title 20 (Appliance Efficiency Regulations),Section 1605.1 (h)(4) and Section 1605.3 (h)(4)(A). Title 20 Section 1605.3 (h)(4)(A): Commercial prerinse spray values manufactured on or after January 1, 2006, shall have a minimum spray force of not less than 4.0 ounces-force (ozf)[113 grams-force(gf)] 4.303.2 Submeters for multifamily buildings and dwelling units in mixed-used residential/commercial buildings. Submeters shall be installed to measure water usage of individual rental dwelling units in accordance with the California Plumbing Code. 4.303.3 Standards for plumbing fixtures and fittings. Plumbing fixtures and fittings shall be installed in accordance with the California Plumbing Code, and shall meet the applicable standards referenced in Table 1701.1 of the California Plumbing Code. TABLE - MAXIMUM FIXTURE WATER USE FIXTURE TYPE FLOW RATE SHOWER HEADS (RESIDENTIAL)1.8 GMP @ 80 PSI LAVATORY FAUCETS (RESIDENTIAL) MAX. 1.2 GPM @ 60 PSI MIN. 0.8 GPM @ 20 PSI LAVATORY FAUCETS IN COMMON & PUBLIC USE AREAS 0.5 GPM @ 60 PSI KITCHEN FAUCETS 1.8 GPM @ 60 PSI METERING FAUCETS 0.2 GAL/CYCLE WATER CLOSET 1.28 GAL/FLUSH URINALS 0.125 GAL/FLUSH 4.304 OUTDOOR WATER USE 4.304.1 OUTDOOR POTABLE WATER USE IN LANDSCAPE AREAS. Residential developments shall comply with a local water efficient landscape ordinance or the current California Department of Water Resources' Model Water Efficient Landscape Ordinance (MWELO), whichever is more stringent. NOTES: 1. The Model Water Efficient Landscape Ordinance (MWELO) is located in the California Code Regulations, Title 23, Chapter 2.7, Division 2. MWELO and supporting documents, including water budget calculator, are available at: https://www.water.ca.gov/ ABBREVIATION DEFINITIONS: HCD Department of Housing and Community Development BSC California Building Standards Commission DSA-SS Division of the State Architect, Structural Safety OSHPD Office of Statewide Health Planning and Development LR Low Rise HR High Rise AA Additions and Alterations N New NOTE: THIS TABLE COMPILES THE DATA IN SECTION 4.303.1, AND IS INCLUDED AS A CONVENIENCE FOR THE USER. SECTION 4.102 DEFINITIONS 4.102.1 DEFINITIONS The following terms are defined in Chapter 2 (and are included here for reference) FRENCH DRAIN. A trench, hole or other depressed area loosely filled with rock, gravel, fragments of brick or similar pervious material used to collect or channel drainage or runoff water. WATTLES. Wattles are used to reduce sediment in runoff. Wattles are often constructed of natural plant materials such as hay, straw or similar material shaped in the form of tubes and placed on a downflow slope. Wattles are also used for perimeter and inlet controls. 4.106 SITE DEVELOPMENT 4.106.1 GENERAL. Preservation and use of available natural resources shall be accomplished through evaluation and careful planning to minimize negative effects on the site and adjacent areas. Preservation of slopes, management of storm water drainage and erosion controls shall comply with this section. 4.106.2 STORM WATER DRAINAGE AND RETENTION DURING CONSTRUCTION. Projects which disturb less than one acre of soil and are not part of a larger common plan of development which in total disturbs one acre or more, shall manage storm water drainage during construction. In order to manage storm water drainage during construction, one or more of the following measures shall be implemented to prevent flooding of adjacent property, prevent erosion and retain soil runoff on the site. 1. Retention basins of sufficient size shall be utilized to retain storm water on the site. 2. Where storm water is conveyed to a public drainage system, collection point, gutter or similar disposal method, water shall be filtered by use of a barrier system, wattle or other method approved by the enforcing agency. 3. Compliance with a lawfully enacted storm water management ordinance. Note: Refer to the State Water Resources Control Board for projects which disturb one acre or more of soil, or are part of a larger common plan of development which in total disturbs one acre or more of soil. (Website: https://www.waterboards.ca.gov/water_issues/programs/stormwater/construction.html) 4.106.3 GRADING AND PAVING. Construction plans shall indicate how the site grading or drainage system will manage all surface water flows to keep water from entering buildings. Examples of methods to manage surface water include, but are not limited to, the following: 1. Swales 2. Water collection and disposal systems 3. French drains 4. Water retention gardens 5. Other water measures which keep surface water away from buildings and aid in groundwater recharge. Exception: Additions and alterations not altering the drainage path. 4.106.4 Electric vehicle (EV) charging for new construction. New construction shall comply with Sections 4.106.4.1, 4.106.4.2, or 4.106.4.3 to facilitate future installation and use of EV chargers. Electric vehicle supply equipment (EVSE) shall be installed in accordance with the California Electrical Code, Article 625. Exceptions: 1. On a case-by-case basis, where the local enforcing agency has determined EV charging and infrastructure are not feasible based upon one or more of the following conditions: 1.1 Where there is no commercial power supply. 1.2 Where there is evidence substantiating that meeting the requirements will alter the local utility infrastructure design requirements on the utility side of the meter so as to increase the utility side cost to the homeowner or the developer by more than $400.00 per dwelling unit. 2. Accessory Dwelling Units (ADU) and Junior Accessory Dwelling Units (JADU) without additional parking facilities. 4.106.4.1 New one- and two-family dwellings and townhouses with attached private garages. For each dwelling unit, install a listed raceway to accommodate a dedicated 208/240-volt branch circuit. The raceway shall not be less than trade size 1 (nominal 1-inch inside diameter). The raceway shall originate at the main service or subpanel and shall terminate into a listed cabinet, box or other enclosure in close proximity to the proposed location of an EV charger. Raceways are required to be continuous at enclosed, inaccessible or concealed areas and spaces. The service panel and/or subpanel shall provide capacity to install a 40-ampere 208/240-volt minimum dedicated branch circuit and space(s) reserved to permit installation of a branch circuit overcurrent protective device. Exemption: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the proposed location of an EV charger at the time of original construction in accordance with the California Electrical Code. 4.106.4.1.1 Identification. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging as "EV CAPABLE". The raceway termination location shall be permanently and visibly marked as "EV CAPABLE". CHAPTER 3 GREEN BUILDING SECTION 301 GENERAL 301.1 SCOPE. Buildings shall be designed to include the green building measures specified as mandatory in the application checklists contained in this code. Voluntary green building measures are also included in the application checklists and may be included in the design and construction of structures covered by this code, but are not required unless adopted by a city, county, or city and county as specified in Section 101.7. 301.1.1 Additions and alterations. [HCD] The mandatory provisions of Chapter 4 shall be applied to additions or alterations of existing residential buildings where the addition or alteration increases the building's conditioned area, volume, or size. The requirements shall apply only to and/or within the specific area of the addition or alteration. Note: On and after January 1, 2014, residential buildings undergoing permitted alterations, additions, or improvements shall replace noncompliant plumbing fixtures with water-conserving plumbing fixtures. Plumbing fixture replacement is required prior to issuance of a certificate of final completion, certificate of occupancy or final permit approval by the local building department. See Civil Code Section 1101.1, et seq., for the definition of a noncompliant plumbing fixture, types of residential buildings affected and other important enactment dates. 301.2 LOW-RISE AND HIGH-RISE RESIDENTIAL BUILDINGS. [HCD] The provisions of individual sections of CALGreen may apply to either low-rise residential buildings high-rise residential buildings, or both. Individual sections will be designated by banners to indicate where the section applies specifically to low-rise only (LR) or high-rise only (HR). When the section applies to both low-rise and high-rise buildings, no banner will be used. SECTION 302 MIXED OCCUPANCY BUILDINGS 302.1 MIXED OCCUPANCY BUILDINGS. In mixed occupancy buildings, each portion of a building shall comply with the specific green building measures applicable to each specific occupancy. Exceptions: 1. [HCD] Accessory structures and accessory occupancies serving residential buildings shall comply with Chapter 4 and Appendix A4, as applicable. 2. [HCD] For purposes of CALGreen, live/work units, complying with Section 419 of the California Building Code, shall not be considered mixed occupancies. Live/Work units shall comply with Chapter 4 and Appendix A4, as applicable. 4.106.4.2 New multifamily dwellings. If residential parking is available, ten (10) percent of the total number of parking spaces on a building site, provided for all types of parking facilities, shall be electric vehicle charging spaces (EV spaces) capable of supporting future EVSE. Calculations for the required number of EV spaces shall be rounded up to the nearest whole number. Notes: 1.Construction documents are intended to demonstrate the project's capability and capacity for facilitating future EV charging. 2. There is no requirement for EV spaces to be constructed or available until EV chargers are installed for use. 3.A parking space served by electric vehicle supply equipment or designated as a future EV charging space shall count as at least one standard automobile parking space for the purpose of complying with any applicable minimum parking space requirements established by a local jurisdiction. See Vehicle Code Section 22511.2 for further details. 4.106.4.2.1 Electric vehicle charging space (EV space) locations. Construction documents shall indicate the location of proposed EV spaces. Where common use parking is provided at least one EV space shall be located in the common use parking area and shall be available for use by all residents. 4.106.4.2.1.1 Electric Vehicle Charging Stations (EVCS) When EV chargers are installed, EV spaces required by Section 4.106.2.2, Item 3, shall comply with at least one of the following options: 1. The EV space shall be located adjacent to an accessible parking space meeting the requirements of the California Building Code, Chapter 11A, to allow use of the EV charger from the accessible parking space. 2. The EV space shall be located on an accessible route, as defined in the California Building Code, Chapter 2, to the building. Exception: Electric vehicle charging stations designed and constructed in compliance with the California Building Code, Chapter 11B, are not required to comply with Section 4.106.4.2.1.1 and Section 4.106.4.2.2, Item 3. Note: Electric Vehicle charging stations serving public housing are required to comply with the California Building Code, Chapter 11B. 4.106.4.2.2 Electric vehicle charging space (EV space) dimensions. The EV space shall be designed to comply with the following: 1. The minimum length of each EV space shall be 18 feet (5486 mm). 2. The minimum width of each EV space shall be 9 feet (2743 mm). 3. One in every 25 EV spaces, but not less than one EV space, shall have an 8-foot (2438 mm) wide minimum aisle. A 5-foot (1524 mm) wide minimum aisle shall be permitted provided the minimum width of the EV space is 12 feet (3658 mm). a. Surface slope for this EV space and the aisle shall not exceed 1 unit vertical in 48 units horizontal (2.083 percent slope) in any direction. 4.106.4.2.3 Single EV space required. Install a listed raceway capable of accommodating a 208/240- volt dedicated branch circuit. The raceway shall not be less than trade size 1 (nominal 1-inch inside diameter). The raceway shall originate at the main service or subpanel and shall terminate into a listed cabinet, box or enclosure in close proximity to the proposed location of the EV space. Construction documents shall identify the raceway termination point. The service panel and/or subpanel shall provide capacity to install a 40-ampere minimum dedicated branch circuit and space(s) reserved to permit installation of a branch circuit overcurrent protective device. Exemption: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the proposed location of an EV charger, at the time of original construction in accordance with the California Electrical Code. 4.106.4.2.4 Multiple EV spaces required. Construction documents shall indicate the raceway termination point and proposed location of future EV spaces and EV chargers. Construction documents shall also provide information on amperage of future EVSE, raceway method(s), wiring schematics and electrical load calculations to verify that the electrical panel service capacity and electrical system, including any on-site distribution transformer(s), have sufficient capacity to simultaneously charge all EVs at all required EV spaces at the full rated amperage of the EVSE. Plan design shall be based upon a 40-ampere minimum branch circuit. Required raceways and related components that are planned to be installed underground, enclosed, inaccessible or in concealed areas and spaces shall be installed at the time of original construction. Exemption: A raceway is not required if a minimum 40-ampere 208/240-volt dedicated EV branch circuit is installed in close proximity to the proposed location of an EV charger, at the time of original construction in accordance with the California Electrical Code. 4.106.4.2.5 Identification. The service panel or subpanel circuit directory shall identify the overcurrent protective device space(s) reserved for future EV charging purposes as "EV CAPABLE" in accordance with the California Electrical Code. 4.106.4.3 New hotels and motels. All newly constructed hotels and motels shall provide EV spaces capable of supporting future installation of EVSE. The construction documents shall identify the location of the EV spaces. Notes: 1. Construction documents are intended to demonstrate the project's capability and capacity or facilitating future EV charging. 2. There is no requirement for EV spaces to be constructed or available until EV chargers are installed for use. 3. A parking space served by electrical vehicle supple equipment or designed as a future EV charging space shall count as at least one standard automobile parking space for the purpose of complying with any applicable minimum parking space requirements established by a local jurisdiction. See Vehicle Code Section 22511.2 for further details. 4.106.4.3.1 Number of required EV spaces. The number of required EV spaces shall be based on the total number of parking spaces provided for all types of parking facilities in accordance with Table 4.106.4.3.1. Calculations for the required number of EV spaces shall be rounded up to the nearest whole number. SECTION 4.501 GENERAL 4.501.1 Scope The provisions of this chapter shall outline means of reducing the quality of air contaminants that are odorous, irritating and/or harmful to the comfort and well being of a building's installers, occupants and neighbors. SECTION 4.502 DEFINITIONS 5.102.1 DEFINITIONS The following terms are defined in Chapter 2 (and are included here for reference) AGRIFIBER PRODUCTS. Agrifiber products include wheatboard, strawboard, panel substrates and door cores, not including furniture, fixtures and equipment (FF&E) not considered base building elements. COMPOSITE WOOD PRODUCTS. Composite wood products include hardwood plywood, particleboard and medium density fiberboard. "Composite wood products" does not include hardboard, structural plywood, structural panels, structural composite lumber, oriented strand board, glued laminated timber, prefabricated wood I-joists or finger-jointed lumber, all as specified in California Code of regulations (CCR), title 17, Section 93120.1. DIRECT-VENT APPLIANCE. A fuel-burning appliance with a sealed combustion system that draws all air for combustion from the outside atmosphere and discharges all flue gases to the outside atmosphere. DISCLAIMER:THIS DOCUMENT IS PROVIDED AND INTENDED TO BE USED AS A MEANS TO INDICATE AREAS OF COMPLIANCE WITH THE CALIFORNIA GREEN BUILDING STANDARDS (CALGREEN) CODE. DUE TO THE VARIABLES BETWEEN BUILDING DEPARTMENT JURISDICTIONS, THIS CHECKLIST IS TO BE USED ON AN INDIVIDUAL PROJECT BASIS AND MAY BE MODIFIED BY THE END USER TO MEET THOSE INDIVIDUAL NEEDS. THE END USER ASSUMES ALL RESPONSIBILITY ASSOCIATED WITH THE USE OF THIS DOCUMENT, INCLUDING VERIFICATION WITH THE FULL CODE. TABLE 4.106.4.3.1 TOTAL NUMBER OF PARKING SPACES NUMBER OF REQUIRED EV SPACES 0-9 0 10-25 1 26-50 2 51-75 4 76-100 5 101-150 7 151-200 10 201 and over 6 percent of total 4.106.4.3.2 Electric vehicle charging space (EV space) dimensions. The EV spaces shall be designed to comply with the following: 1. The minimum length of each EV space shall be 18 feet (5486mm). 2. The minimum width of each EV space shall be 9 feet (2743mm) 4.106.4.3.3 Single EV space required. When a single EV space is required, the EV space shall be designed in accordance with Section 4.106.4.2.3. 4.106.4.3.4 Multiple EV spaces required. When multiple EV spaces are required, the EV spaces shall be designed in accordance with Section 4.106.4.2.4. 4.106.4.3.5 Identification. The service panels or sub-panels shall be identified in accordance with Section 4.106.4.2.5. 4.106.4.3.6 Accessible EV spaces. In addition to the requirements in Section 4.106.4.3, EV spaces for hotels/motels and all EVSE, when installed, shall comply with the accessibility provisions for the EV charging stations in the California Building Code, Chapter 11B. Y N/AYN/AYN/AYN/A RESPON. PARTY RESPON. PARTY RESPON. PARTY RESPON. PARTY 2022 CALIFORNIA GREEN BUILDING STANDARDS CODE RESIDENTIAL MANDATORY MEASURES, SHEET 1 Y = YES N/A =NOT APPLICABLE RESPON. PARTY =RESPONSIBLE PARTY (ie: ARCHITECT, ENGINEER, OWNER, CONTRACTOR, INSPECTOR ETC.) 4.201 GENERAL 4.201.1 SCOPE. For the purposes of mandatory energy efficiency standards in this code, the California Energy Commission will continue to adopt mandatory standards. DIVISION 4.2 ENERGY EFFICIENCY TABLE H-2 STANDARDS FOR COMMERCIAL PRE-RINSE SPRAY VALUES MANUFACTURED ON OR AFTER JANUARY 28, 2019 PRODUCT CLASS [spray force in ounce force (ozf)]MAXIMUM FLOW RATE (gpm) Product Class 1 (≤1.00 Product Class 2 (> 5.0 ozf and ≤1.20 Product Class 3 (> 8.0 ozf)1.28 CALG-1 CA L G r e e n B U I L D I N G S T A N D A R D S C O D E REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 DE S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 HOLD - 1001 N Van Ness Ave3/7/2025 MAXIMUM INCREMENTAL REACTIVITY (MIR). The maximum change in weight of ozone formed by adding a compound to the "Base Reactive Organic Gas (ROG) Mixture" per weight of compound added, expressed to hundredths of a gram (g O³/g ROC). Note: MIR values for individual compounds and hydrocarbon solvents are specified in CCR, Title 17, Sections 94700 and 94701. MOISTURE CONTENT. The weight of the water in wood expressed in percentage of the weight of the oven-dry wood. PRODUCT-WEIGHTED MIR (PWMIR). The sum of all weighted-MIR for all ingredients in a product subject to this article. The PWMIR is the total product reactivity expressed to hundredths of a gram of ozone formed per gram of product (excluding container and packaging). Note: PWMIR is calculated according to equations found in CCR, Title 17, Section 94521 (a). REACTIVE ORGANIC COMPOUND (ROC). Any compound that has the potential, once emitted, to contribute to ozone formation in the troposphere. VOC. A volatile organic compound (VOC) broadly defined as a chemical compound based on carbon chains or rings with vapor pressures greater than 0.1 millimeters of mercury at room temperature. These compounds typically contain hydrogen and may contain oxygen, nitrogen and other elements. See CCR Title 17, Section 94508(a). 4.503 FIREPLACES 4.503.1 GENERAL. Any installed gas fireplace shall be a direct-vent sealed-combustion type. Any installed woodstove or pellet stove shall comply with U.S. EPA New Source Performance Standards (NSPS) emission limits as applicable, and shall have a permanent label indicating they are certified to meet the emission limits. Woodstoves, pellet stoves and fireplaces shall also comply with applicable local ordinances. 4.504 POLLUTANT CONTROL 4.504.1 COVERING OF DUCT OPENINGS & PROTECTION OF MECHANICAL EQUIPMENT DURING CONSTRUCTION. At the time of rough installation, during storage on the construction site and until final startup of the heating, cooling and ventilating equipment, all duct and other related air distribution component openings shall be covered with tape, plastic, sheet metal or other methods acceptable to the enforcing agency to reduce the amount of water, dust or debris which may enter the system. 4.504.2 FINISH MATERIAL POLLUTANT CONTROL. Finish materials shall comply with this section. 4.504.2.1 Adhesives, Sealants and Caulks. Adhesives, sealant and caulks used on the project shall meet the requirements of the following standards unless more stringent local or regional air pollution or air quality management district rules apply: 1. Adhesives, adhesive bonding primers, adhesive primers, sealants, sealant primers and caulks shall comply with local or regional air pollution control or air quality management district rules where applicable or SCAQMD Rule 1168 VOC limits, as shown in Table 4.504.1 or 4.504.2, as applicable. Such products also shall comply with the Rule 1168 prohibition on the use of certain toxic compounds (chloroform, ethylene dichloride, methylene chloride, perchloroethylene and tricloroethylene), except for aerosol products, as specified in Subsection 2 below. 2. Aerosol adhesives, and smaller unit sizes of adhesives, and sealant or caulking compounds (in units of product, less packaging, which do not weigh more than 1 pound and do not consist of more than 16 fluid ounces) shall comply with statewide VOC standards and other requirements, including prohibitions on use of certain toxic compounds, of California Code of Regulations, Title 17, commencing with section 94507. 4.504.2.2 Paints and Coatings. Architectural paints and coatings shall comply with VOC limits in Table 1 of the ARB Architectural Suggested Control Measure, as shown in Table 4.504.3, unless more stringent local limits apply. The VOC content limit for coatings that do not meet the definitions for the specialty coatings categories listed in Table 4.504.3 shall be determined by classifying the coating as a Flat, Nonflat or Nonflat-High Gloss coating, based on its gloss, as defined in subsections 4.21, 4.36, and 4.37 of the 2007 California Air Resources Board, Suggested Control Measure, and the corresponding Flat, Nonflat or Nonflat-High Gloss VOC limit in Table 4.504.3 shall apply. 4.504.2.3 Aerosol Paints and Coatings. Aerosol paints and coatings shall meet the Product-weighted MIR Limits for ROC in Section 94522(a)(2) and other requirements, including prohibitions on use of certain toxic compounds and ozone depleting substances, in Sections 94522(e)(1) and (f)(1) of California Code of Regulations, Title 17, commencing with Section 94520; and in areas under the jurisdiction of the Bay Area Air Quality Management District additionally comply with the percent VOC by weight of product limits of Regulation 8, Rule 49. 4.504.2.4 Verification. Verification of compliance with this section shall be provided at the request of the enforcing agency. Documentation may include, but is not limited to, the following: 1. Manufacturer's product specification. 2. Field verification of on-site product containers. CHAPTER 7 INSTALLER & SPECIAL INSPECTOR QUALIFICATIONS 702 QUALIFICATIONS 702.1 INSTALLER TRAINING. HVAC system installers shall be trained and certified in the proper installation of HVAC systems including ducts and equipment by a nationally or regionally recognized training or certification program. Uncertified persons may perform HVAC installations when under the direct supervision and responsibility of a person trained and certified to install HVAC systems or contractor licensed to install HVAC systems. Examples of acceptable HVAC training and certification programs include but are not limited to the following: 1. State certified apprenticeship programs. 2. Public utility training programs. 3. Training programs sponsored by trade, labor or statewide energy consulting or verification organizations. 4. Programs sponsored by manufacturing organizations. 5. Other programs acceptable to the enforcing agency. 702.2 SPECIAL INSPECTION [HCD]. When required by the enforcing agency, the owner or the responsible entity acting as the owner's agent shall employ one or more special inspectors to provide inspection or other duties necessary to substantiate compliance with this code. Special inspectors shall demonstrate competence to the satisfaction of the enforcing agency for the particular type of inspection or task to be performed. In addition to other certifications or qualifications acceptable to the enforcing agency, the following certifications or education may be considered by the enforcing agency when evaluating the qualifications of a special inspector: 1. Certification by a national or regional green building program or standard publisher. 2. Certification by a statewide energy consulting or verification organization, such as HERS raters, building performance contractors, and home energy auditors. 3. Successful completion of a third party apprentice training program in the appropriate trade. 4. Other programs acceptable to the enforcing agency. Notes: 1. Special inspectors shall be independent entities with no financial interest in the materials or the project they are inspecting for compliance with this code. 2. HERS raters are special inspectors certified by the California Energy Commission (CEC) to rate homes in California according to the Home Energy Rating System (HERS). [BSC] When required by the enforcing agency, the owner or the responsible entity acting as the owner's agent shall employ one or more special inspectors to provide inspection or other duties necessary to substantiate compliance with this code. Special inspectors shall demonstrate competence to the satisfaction of the enforcing agency for the particular type of inspection or task to be performed. In addition, the special inspector shall have a certification from a recognized state, national or international association, as determined by the local agency. The area of certification shall be closely related to the primary job function, as determined by the local agency. Note: Special inspectors shall be independent entities with no financial interest in the materials or the project they are inspecting for compliance with this code. 703 VERIFICATIONS 703.1 DOCUMENTATION. Documentation used to show compliance with this code shall include but is not limited to, construction documents, plans, specifications, builder or installer certification, inspection reports, or other methods acceptable to the enforcing agency which demonstrate substantial conformance. When specific documentation or special inspection is necessary to verify compliance, that method of compliance will be specified in the appropriate section or identified applicable checklist. 4.505 INTERIOR MOISTURE CONTROL 4.505.1 General. Buildings shall meet or exceed the provisions of the California Building Standards Code. 4.505.2 CONCRETE SLAB FOUNDATIONS. Concrete slab foundations required to have a vapor retarder by California Building Code, Chapter 19, or concrete slab-on-ground floors required to have a vapor retarder by the California Residential Code, Chapter 5, shall also comply with this section. 4.505.2.1 Capillary break. A capillary break shall be installed in compliance with at least one of the following: 1. A 4-inch (101.6 mm) thick base of 1/2 inch (12.7mm) or larger clean aggregate shall be provided with a vapor barrier in direct contact with concrete and a concrete mix design, which will address bleeding, shrinkage, and curling, shall be used. For additional information, see American Concrete Institute, ACI 302.2R-06. 2. Other equivalent methods approved by the enforcing agency. 3. A slab design specified by a licensed design professional. 4.505.3 MOISTURE CONTENT OF BUILDING MATERIALS. Building materials with visible signs of water damage shall not be installed. Wall and floor framing shall not be enclosed when the framing members exceed 19 percent moisture content. Moisture content shall be verified in compliance with the following: 1. Moisture content shall be determined with either a probe-type or contact-type moisture meter.Equivalent moisture verification methods may be approved by the enforcing agency and shall satisfy requirements found in Section 101.8 of this code. 2. Moisture readings shall be taken at a point 2 feet (610 mm) to 4 feet (1219 mm) from the grade stamped end of each piece verified. 3. At least three random moisture readings shall be performed on wall and floor framing with documentation acceptable to the enforcing agency provided at the time of approval to enclose the wall and floor framing. Insulation products which are visibly wet or have a high moisture content shall be replaced or allowed to dry prior to enclosure in wall or floor cavities. Wet-applied insulation products shall follow the manufacturers' drying recommendations prior to enclosure. 4.506 INDOOR AIR QUALITY AND EXHAUST 4.506.1 Bathroom exhaust fans. Each bathroom shall be mechanically ventilated and shall comply with the following: 1. Fans shall be ENERGY STAR compliant and be ducted to terminate outside the building. 2. Unless functioning as a component of a whole house ventilation system, fans must be controlled by a humidity control. a. Humidity controls shall be capable of adjustment between a relative humidity range less than or equal to 50% to a maximum of 80%. A humidity control may utilize manual or automatic means of adjustment. b. A humidity control may be a separate component to the exhaust fan and is not required to be integral (i.e., built-in) Notes: 1. For the purposes of this section, a bathroom is a room which contains a bathtub, shower or tub/shower combination. 2. Lighting integral to bathroom exhaust fans shall comply with the California Energy Code. 4.507 ENVIRONMENTAL COMFORT 4.507.2 HEATING AND AIR-CONDITIONING SYSTEM DESIGN. Heating and air conditioning systems shall be sized, designed and have their equipment selected using the following methods: 1. The heat loss and heat gain is established according to ANSI/ACCA 2 Manual J - 2011 (Residential Load Calculation), ASHRAE handbooks or other equivalent design software or methods. 2. Duct systems are sized according to ANSI/ACCA 1 Manual D - 2014 (Residential Duct Systems), ASHRAE handbooks or other equivalent design software or methods. 3. Select heating and cooling equipment according to ANSI/ACCA 3 Manual S - 2014 (Residential Equipment Selection), or other equivalent design software or methods. Exception: Use of alternate design temperatures necessary to ensure the system functions are acceptable. TABLE 4.504.1 - ADHESIVE VOC LIMIT1,2 (Less Water and Less Exempt Compounds in Grams per Liter) ARCHITECTURAL APPLICATIONS VOC LIMIT INDOOR CARPET ADHESIVES 50 CARPET PAD ADHESIVES 50 OUTDOOR CARPET ADHESIVES 150 WOOD FLOORING ADHESIVES 100 RUBBER FLOOR ADHESIVES 60 SUBFLOOR ADHESIVES 50 CERAMIC TILE ADHESIVES 65 VCT & ASPHALT TILE ADHESIVES 50 DRYWALL & PANEL ADHESIVES 50 COVE BASE ADHESIVES 50 MULTIPURPOSE CONSTRUCTION ADHESIVE 70 STRUCTURAL GLAZING ADHESIVES 100 SINGLE-PLY ROOF MEMBRANE ADHESIVES 250 OTHER ADHESIVES NOT LISTED 50 SPECIALTY APPLICATIONS PVC WELDING 510 CPVC WELDING 490 ABS WELDING 325 PLASTIC CEMENT WELDING 250 ADHESIVE PRIMER FOR PLASTIC 550 CONTACT ADHESIVE 80 SPECIAL PURPOSE CONTACT ADHESIVE 250 STRUCTURAL WOOD MEMBER ADHESIVE 140 TOP & TRIM ADHESIVE 250 SUBSTRATE SPECIFIC APPLICATIONS METAL TO METAL 30 PLASTIC FOAMS 50 POROUS MATERIAL (EXCEPT WOOD)50 WOOD 30 FIBERGLASS 80 1. IF AN ADHESIVE IS USED TO BOND DISSIMILAR SUBSTRATES TOGETHER, THE ADHESIVE WITH THE HIGHEST VOC CONTENT SHALL BE ALLOWED. 2. FOR ADDITIONAL INFORMATION REGARDING METHODS TO MEASURE THE VOC CONTENT SPECIFIED IN THIS TABLE, SEE SOUTH COAST AIR QUALITY MANAGEMENT DISTRICT RULE 1168. TABLE 4.504.2 - SEALANT VOC LIMIT (Less Water and Less Exempt Compounds in Grams per Liter) SEALANTS VOC LIMIT ARCHITECTURAL 250 MARINE DECK 760 NONMEMBRANE ROOF 300 ROADWAY 250 SINGLE-PLY ROOF MEMBRANE 450 OTHER 420 SEALANT PRIMERS ARCHITECTURAL NON-POROUS 250 POROUS 775 MODIFIED BITUMINOUS 500 MARINE DECK 760 OTHER 750 TABLE 4.504.5 - FORMALDEHYDE LIMITS1 MAXIMUM FORMALDEHYDE EMISSIONS IN PARTS PER MILLION PRODUCT CURRENT LIMIT HARDWOOD PLYWOOD VENEER CORE 0.05 HARDWOOD PLYWOOD COMPOSITE CORE 0.05 PARTICLE BOARD 0.09 MEDIUM DENSITY FIBERBOARD 0.11 THIN MEDIUM DENSITY FIBERBOARD2 0.13 1. VALUES IN THIS TABLE ARE DERIVED FROM THOSE SPECIFIED BY THE CALIF. AIR RESOURCES BOARD, AIR TOXICS CONTROL MEASURE FOR COMPOSITE WOOD AS TESTED IN ACCORDANCE WITH ASTM E 1333. FOR ADDITIONAL INFORMATION, SEE CALIF. CODE OF REGULATIONS, TITLE 17, SECTIONS 93120 THROUGH 93120.12. 2. THIN MEDIUM DENSITY FIBERBOARD HAS A MAXIMUM THICKNESS OF 5/16" (8 MM). TABLE 4.504.3 - VOC CONTENT LIMITS FOR ARCHITECTURAL COATINGS2,3 GRAMS OF VOC PER LITER OF COATING, LESS WATER & LESS EXEMPT COMPOUNDS COATING CATEGORY VOC LIMIT FLAT COATINGS 50 NON-FLAT COATINGS 100 NONFLAT-HIGH GLOSS COATINGS 150 SPECIALTY COATINGS ALUMINUM ROOF COATINGS 400 BASEMENT SPECIALTY COATINGS 400 BITUMINOUS ROOF COATINGS 50 BITUMINOUS ROOF PRIMERS 350 BOND BREAKERS 350 CONCRETE CURING COMPOUNDS 350 CONCRETE/MASONRY SEALERS 100 DRIVEWAY SEALERS 50 DRY FOG COATINGS 150 FAUX FINISHING COATINGS 350 FIRE RESISTIVE COATINGS 350 FLOOR COATINGS 100 FORM-RELEASE COMPOUNDS 250 GRAPHIC ARTS COATINGS (SIGN PAINTS)500 HIGH TEMPERATURE COATINGS 420 INDUSTRIAL MAINTENANCE COATINGS 250 LOW SOLIDS COATINGS1 120 MAGNESITE CEMENT COATINGS 450 MASTIC TEXTURE COATINGS 100 METALLIC PIGMENTED COATINGS 500 MULTICOLOR COATINGS 250 PRETREATMENT WASH PRIMERS 420 PRIMERS, SEALERS, & UNDERCOATERS 100 REACTIVE PENETRATING SEALERS 350 RECYCLED COATINGS 250 ROOF COATINGS 50 RUST PREVENTATIVE COATINGS 250 SHELLACS CLEAR 730 OPAQUE 550 SPECIALTY PRIMERS, SEALERS & UNDERCOATERS 100 STAINS 250 STONE CONSOLIDANTS 450 SWIMMING POOL COATINGS 340 TRAFFIC MARKING COATINGS 100 TUB & TILE REFINISH COATINGS 420 WATERPROOFING MEMBRANES 250 WOOD COATINGS 275 WOOD PRESERVATIVES 350 ZINC-RICH PRIMERS 340 1. GRAMS OF VOC PER LITER OF COATING, INCLUDING WATER & EXEMPT COMPOUNDS 2. THE SPECIFIED LIMITS REMAIN IN EFFECT UNLESS REVISED LIMITS ARE LISTED IN SUBSEQUENT COLUMNS IN THE TABLE. 3. VALUES IN THIS TABLE ARE DERIVED FROM THOSE SPECIFIED BY THE CALIFORNIA AIR RESOURCES BOARD, ARCHITECTURAL COATINGS SUGGESTED CONTROL MEASURE, FEB. 1, 2008. MORE INFORMATION IS AVAILABLE FROM THE AIR RESOURCES BOARD. DIVISION 4.5 ENVIRONMENTAL QUALITY (continued) 4.504.3 CARPET SYSTEMS. All carpet installed in the building interior shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. https://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.3.1 Carpet cushion. All carpet cushion installed in the building interior shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. https://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.3.2 Carpet adhesive. All carpet adhesive shall meet the requirements of Table 4.504.1. 4.504.4 RESILIENT FLOORING SYSTEMS. Where resilient flooring is installed , at least 80% of floor area receiving resilient flooring shall meet the requirements of the California Department of Public Health, "Standard Method for the Testing and Evaluation of Volatile Organic Chemical Emissions from Indoor Sources Using Environmental Chambers," Version 1.2, January 2017 (Emission testing method for California Specification 01350) See California Department of Public Health's website for certification programs and testing labs. hhtps://www.cdph.ca.gov/Programs/CCDPHP/DEODC/EHLB/IAQ/Pages/VOC.aspx. 4.504.5 COMPOSITE WOOD PRODUCTS. Hardwood plywood, particleboard and medium density fiberboard composite wood products used on the interior or exterior of the buildings shall meet the requirements for formaldehyde as specified in ARB's Air Toxics Control Measure for Composite Wood (17 CCR 93120 et seq.), by or before the dates specified in those sections, as shown in Table 4.504.5 4.504.5.1 Documentation. Verification of compliance with this section shall be provided as requested by the enforcing agency. Documentation shall include at least one of the following: 1. Product certifications and specifications. 2. Chain of custody certifications. 3. Product labeled and invoiced as meeting the Composite Wood Products regulation (see CCR, Title 17, Section 93120, et seq.). 4. Exterior grade products marked as meeting the PS-1 or PS-2 standards of the Engineered Wood Association, the Australian AS/NZS 2269, European 636 3S standards, and Canadian CSA 0121, CSA 0151, CSA 0153 and CSA 0325 standards. 5. Other methods acceptable to the enforcing agency. DISCLAIMER:THIS DOCUMENT IS PROVIDED AND INTENDED TO BE USED AS A MEANS TO INDICATE AREAS OF COMPLIANCE WITH THE CALIFORNIA GREEN BUILDING STANDARDS (CALGREEN) CODE. DUE TO THE VARIABLES BETWEEN BUILDING DEPARTMENT JURISDICTIONS, THIS CHECKLIST IS TO BE USED ON AN INDIVIDUAL PROJECT BASIS AND MAY BE MODIFIED BY THE END USER TO MEET THOSE INDIVIDUAL NEEDS. THE END USER ASSUMES ALL RESPONSIBILITY ASSOCIATED WITH THE USE OF THIS DOCUMENT, INCLUDING VERIFICATION WITH THE FULL CODE. Y N/AYN/AYN/AYN/A RESPON. PARTY RESPON. PARTY RESPON. PARTY RESPON. PARTY 2022 CALIFORNIA GREEN BUILDING STANDARDS CODE RESIDENTIAL MANDATORY MEASURES, SHEET 1 Y = YES N/A =NOT APPLICABLE RESPON. PARTY =RESPONSIBLE PARTY (ie: ARCHITECT, ENGINEER, OWNER, CONTRACTOR, INSPECTOR ETC.) CALG-2 CA L G r e e n B U I L D I N G S T A N D A R D S C O D E REVISION NO. DR A W I N G T I T L E JO B T I T L E DWG. NO. PROJECT NO. JO B A D D R E S S DA T E NO . IS S U E D 2024-63 DE S I G N C O N C E P T S SH I V T A L W A R , A R C H I T E C T A I A 33 4 0 R I V E R S I D E D R . # M , C H I N O , C A 9 1 7 1 0 TE L : 9 0 9 - 5 9 1 - 3 9 3 9 E m a i l : d s i g n c o n c e p t s @ y a h o o . c o m TH E S E D R A W I N G S A N D SP E C I F I C A T I O N S A R E T H E PR O P E R T Y A N D C O P Y R I G H T O F TH E A R C H I T E C T A N D S H A L L N O T BE U S E D O N A N Y O T H E R W O R K EX C E P T B Y A G R E E M E N T W I T H TH E A R C H I T E C T . W R I T T E N DI M E N S I O N S S H A L L T A K E PR E F E R E N C E O V E R S C A L E D DI M E N S I O N S A N D S H A L L B E VE R I F I E D O N T H E J O B S I T E . A N Y DI S C R E P A N C Y S H A L L B E BR O U G H T T O T H E N O T I C E O F T H E AR C H I T E C T P R I O R T O T H E CO M M E N C E M E N T O F A N Y W O R K . 7/ 1 9 / 2 4 PL A N C H E C K 1 2 3 4 5 BA L C O N Y R E P A I R F O R U N I T I 10 0 1 N . V A N N E S S SA N T A A N A , C A 9 2 7 0 1 HOLD - 1001 N Van Ness Ave3/7/2025 HOLD - 1001 N Van Ness Ave3/7/2025 HOLD - 1001 N Van Ness Ave3/7/2025 HOLD - 1001 N Van Ness Ave3/7/2025 10" 10 " 10 " 852.5 lbs 10x1705 / 20 = 852.5 lbs 852.5 lbs : OK HOLD - 1001 N Van Ness Ave3/7/2025  z^EK                 ,16758&7,216 25$1*( &2817< ),5( $87+25,7< 3ODQ6XEPLWWDO&ULWHULD &200(5&,$/SURMHFWV08/7,)$0,/<5(6,'(17,$/SURMHFWV DQG5(6,'(17,$/75$&7GHYHORSPHQWV  )LOOLQWKHSURMHFWEXVLQHVVDGGUHVVDQGSURYLGHDEULHIGHVFULSWLRQRIWKHVFRSHRIZRUNDQGW\SHRIEXVLQHVVRSHUDWLRQWKDWZLOOWDNHSODFH  $QVZHUTXHVWLRQVWKURXJKUHDGDQGLQLWLDOLWHPVDQGWKHQFRPSOHWHDQGVLJQWKHFHUWLILFDWLRQVHFWLRQ  ,I\RXDQVZHU³<(6´WRDQ\SDUWRITXHVWLRQVWKURXJKVXEPLWWKHW\SHRISODQLQGLFDWHGLQLWDOLFVWR2&)$  ,QVRPHFDVHVRWKHUSODQW\SHVQRWLQGLFDWHGKHUHLQPD\DOVREHQHFHVVDU\GHSHQGLQJRQVSHFLILFFRQGLWLRQVRURSHUDWLRQV  9LVLWZZZRFIDRUJIRUVXEPLWWDOLQIRUPDWLRQDQGORFDWLRQV,I\RXQHHGDVVLVWDQFHLQILOOLQJRXWWKLVIRUPRUKDYHTXHVWLRQVUHJDUGLQJ UHTXLUHPHQWVIRUUHYLHZSOHDVHFRQWDFW2&)$DWRUYLVLWXVDW)LUH$XWKRULW\5RDG,UYLQH&$  $GGUHVV6XLWH&LW\ 3URMHFW6FRSH%XVLQHVV'HVFULSWLRQ  &RQVWUXFWLRQRIDQHZEXLOGLQJDQHZVWRU\RULQFUHDVHWKHIRRWSULQWRIDQH[LVWLQJEXLOGLQJ" &KDQJHVWRURDGZD\V FXUEVRU GULYH DLVOHV" $GGLWLRQ UHORFDWLRQRU PRGLILFDWLRQ RI ILUH K\GUDQWV RUIHQFHVJDWHV" &RQVWUXFWLRQ ZLWKLQ IHHWRIDQDFWLYHRUSURSRVHGRLOZHOO")LUH0DVWHU3ODQ 35  3URSHUW\LVDGMDFHQWWRDZLOGODQGDUHDRUQRQLUULJDWHGQDWLYHYHJHWDWLRQ" )LUH0DVWHU3ODQ 35 D)XHO0RGLILFDWLRQ3ODQPD\DOVREHUHTXLUHG 3535  /RFDWHGLQRU¶IURPD'LYLVLRQRI2LO*DVDQG*HRWKHUPDO5HVRXUFHV '2**5 ILHOGERXQGDU\¶IURP DQRLOJDVVHHSRU¶IURPDODQGILOO"0HWKDQH:RUN3ODQ 35  ,QVWDOODWLRQPRGLILFDWLRQUHSDLURIXQGHUJURXQGSLSLQJEDFNIORZSUHYHQWHUVRUILUHGHSDUWPHQWFRQQHFWLRQVVHUYLQJ SULYDWHILUHK\GUDQWVSULQNOHUVWDQGSLSHV\VWHPV"8QGHUJURXQG3ODQ 3535  'ULQNLQJGLQLQJUHFUHDWLRQPHHWLQJVWUDLQLQJUHOLJLRXVIXQFWLRQVRURWKHUJDWKHULQJVLQDURRP!VTIW ! VTIWIRUWUDLQLQJDGXOWHGXFDWLRQ RU!SHRSOH"+HDOWKFDUHRXWSDWLHQWVHUYLFHVIRU!SHRSOHZKRPD\EHXQDEOH WRLPPHGLDWHO\HYDFXDWHZLWKRXWDVVLVWDQFH"(GXFDWLRQIRUFKLOGUHQ DFDGHPLFWXWRULQJIRUDJHVLVH[HPSWXQOHVV FODVVLILHGDVDQ(RFFXSDQF\E\WKH%XLOGLQJ2IILFLDO "$GXOWFKLOGGD\FDUH"KRXUFDUHVXSHUYLVLRQ",QFDUFHUDWLRQ RU UHVWUDLQW" +RWHODSDUWPHQW RU UHVLGHQWLDO IDFLOLW\ ZLWK  XQLWV DQG  VWRULHV VWRU\ WRZQKRXVHVURZKRXVHV ZKHUHDQLQGHSHQGHQWGLUHFWH[LWWRJUDGHLVSURYLGHGIRUGZHOOLQJDUHH[HPSW "&RQJUHJDWHKRXVLQJGRUPLWRULHV ZLWKSHRSOH" +LJKULVHVWUXFWXUH IHHWWRKLJKHVWRFFXSLHGIORRUOHYHO "$UFKLWHFWXUDO3ODQ 3535  ,QVWDOODWLRQPRGLILFDWLRQRIORFNVGHOD\LQJRUSUHYHQWLQJRFFXSDQWVIURPOHDYLQJDVSDFHRUUHTXLULQJXVHRIDFDUG EXWWRQ RU VLPLODU DFWLRQ WR RSHQ D GRRU LQ WKH GLUHFWLRQ RI H[LW WUDYHO"$UFKLWHFWXUDO 6SULQNOHU DQGRU $ODUP 3ODQ GHSHQGLQJRQWKHRFFXSDQF\DQGW\SHRIGHYLFHLQVWDOOHG 353535353535  ,QVWDOODWLRQPRGLILFDWLRQXVH RI VSUD\ ERRWKV GXVW FROOHFWLRQ GU\ FOHDQLQJ LQGXVWULDO RYHQVGU\LQJ HTXLSPHQW LQGXVWULDOFRPPHUFLDO UHIULJHUDWLRQ V\VWHPV FRPSUHVVHG JDVVHV WDQNV IRU FU\RJHQLF RU IODPPDEOHFRPEXVWLEOH OLTXLGVYDSRUUHFRYHU\VPRNHFRQWUROEDWWHU\EDFNXSFKDUJLQJV\VWHPV !JDOHOHFWURO\WH!OEOLWKLXP LRQ ZHOGLQJEUD]LQJVROGHULQJRSHQIODPHWRUFKHVFXWWLQJJULQGLQJRURWKHUVLPLODURSHUDWLRQV" 6SHFLDO(TXLSPHQW3ODQ 353535  6WRUDJHXVHUHVHDUFK ZLWK IODPPDEOHFRPEXVWLEOH OLTXLGV RU RWKHU FKHPLFDOV" 0RWRU YHKLFOHDLUFUDIW PDLQWHQDQFHUHSDLU"&DELQHWU\ZRRGZRUNLQJILQLVKLQJ IDFLOLW\"&KHP &ODVV  IORRU SODQ IXOO DUFKLWHFWXUDO SODQ LI +RFFXSDQF\ 6SHFLDO(TXLSPHQW3ODQVPD\EHQHFHVVDU\ 35353535  6WRUDJHRUPHUFKDQGL]LQJDUHDVLQH[FHVVRIVTIWZKHUHLWHPVDUHORFDWHGKLJKHUWKDQ¶ ¶IRUKLJKKD]DUG FRPPRGLWLHVSODVWLFUXEEHUIRDPHWF "+LJKSLOHG6WRUDJH3ODQ 35  &RRNLQJXQGHUD7\SH,FRPPHUFLDOKRRGLQVWDOODWLRQRUPRGLILFDWLRQRIDILUHH[WLQJXLVKLQJV\VWHPORFDWHGLQD FRPPHUFLDOFRRNLQJKRRG"+RRG 'XFW([WLQJXLVKLQJ6\VWHPQRWMXVWWKHKRRGPHFKDQLFDOSODQ 35  ,QLWLDOHDFKRIWKHIROORZLQJWZRLWHPVLQGLFDWLQJWKDW\RXKDYHUHDGDQGXQGHUVWDQGWKHVWDWHPHQW  6SULQNOHUV$ODUPV &RQVXOW %XLOGLQJ)LUH &RGHV DQG RUGLQDQFHV WR GHWHUPLQH VSULQNOHUDODUP UHTXLUHPHQWV LI D  V\VWHP  LV UHTXLUHGSODQVVKDOOEHVXEPLWWHGIRU2&)$UHYLHZ([LVWLQJEXLOGLQJVXQGHUJRLQJUHPRGHOPXVWEHHYDOXDWHGE\DOLFHQVHG /ŶŝƚŝĂůƐFRQWUDFWRUWRGHWHUPLQHLIPRGLILFDWLRQLVQHHGHGLIVRFRQWUDFWRUVKDOOVXEPLWSODQVSULRUWRPDNLQJPRGLILFDWLRQV  )LUH+D]DUG6HYHULW\=RQH&RQVXOWPDSVDYDLODEOHDWEXLOGLQJGHSDUWPHQWRURQ2&)$ZHEVLWHWRGHWHUPLQHLI\RXUVLWHLVORFDWHG LQD)+6=%XLOGLQJVLQD)+6=PD\EHVXEMHFWWRVSHFLDOFRQVWUXFWLRQUHTXLUHPHQWVGHWDLOHGLQ&%&&KDSWHU$RU&5&5² /ŶŝƚŝĂůƐWKHEXLOGLQJGHSDUWPHQWZLOOGHWHUPLQHVSHFLILFUHTXLUHPHQWV ,FHUWLI\XQGHUSHQDOW\RISHUMXU\XQGHUWKHODZVRIWKH6WDWHRI&DOLIRUQLDWKDWWKHDERYHLVWUXH  3ULQW1DPH6LJQDWXUH 3KRQH1XPEHU;'DWHͬ %XLOGLQJ'HSDUWPHQW,I\RXKDYHYHULILHGWKDWDOORIWKHTXHVWLRQVKDYHEHHQDQVZHUHGDFFXUDWHO\DV³12´DQGWKHSURMHFWGRHVQRWRWKHUZLVHUHTXLUH2&)$ UHYLHZRIVSULQNOHURUDODUPSODQV WKHQ\RXPD\DFFHSWWKLVVLJQHGIRUPDVDZULWWHQUHOHDVHWKDW2&)$UHYLHZLVQRWUHTXLUHG6KRXOG\RXVWLOOUHTXLUHWKDWWKH DSSOLFDQWKDYHSODQVDSSURYHGE\2&)$SOHDVHLQLWLDOKHUH RUDWWDFKDQ2&)$UHIHUUDOIRUPDQGKDYHWKHDSSOLFDQWVXEPLWWKHIRUPDORQJZLWKWKH DSSURSULDWHSODQVDQGIHHVIRU2&)$UHYLHZϭϬͲϬϴͲϭϰ KD 1001 N Van Ness Ave I ✔ REPAIR BALCONY AS REQUIRED BY SB721 · SEVERE LEVEL JOIST/RIM JOIST/BEAM AND LEDGER DEFECT - SEVERE DAMAGE TO WOOD FRAME COMPONENTS ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ SHIV TAL WAR Digitally signed by SHIV TALWAR Date: 2024.10.21 14:00:08 -07'00' SHIV TALW R Digitally signed by SHIV TALWAR Date: 2024.10.21 14:00:55 -07'00' SHIV TALWAR 909 510 0512 10 21 2024 SANTA ANA ST HOLD - 1001 N Van Ness Ave3/7/2025 Product Data Sheet Sikaflex® Concrete Fix July 2018, Version 01.02 020511010000000023 PRODUCT DATA SHEET Sikaflex® Concrete Fix One-component, non-sag, polyurethane sealant for sealing cracks/joints PRODUCT DESCRIPTION Sikaflex® Concrete Fix is a moisture-cured, 1-component, polyurethane-based, non-sag elastomeric sealant. Meets Federal specification TT-S-00230C, Type II. Meets ASTM C-920, Type S, Grade NS. USES Designed for all types of joints and cracks where maximum depth of sealant will not exceed 1/2 in. (12.7 mm). ▪ Suitable for vertical and horizontal joints; readily placeable at 40 °F (4 °C). ▪ Has many applications as an elastic sealant between materials with dissimilar coefficients of expansion. ▪ Ideal for: Weatherproofing of joints,cracks and gaps in concrete, brickwork, blockwork, masonry, stucco and metal frames ▪ Joints in walls, floors, balconies, around window or door frames ▪ Expansion joints▪ Roofing▪ CHARACTERISTICS / ADVANTAGES High elasticity – cures to a tough, durable, flexible consistency with exceptional cut and tearresistance. ▪ Stress relaxation▪ Excellent adhesion – bonds to most construction materials without a primer. ▪ Excellent resistance to aging, weathering▪ Non-staining▪ Urethane-based; suggested by EPA for radon reduction▪ Paintable with water-based, oil-based or rubber-based paints ▪ Capable of ±35 % joint movement▪ PRODUCT INFORMATION Packaging 10.1 fl. oz. (299 ml), moisture-proof composite cartridges, 12/case Color Limestone Shelf Life 12 months in original, unopened containers Storage Conditions Store at 40 to 95 °F (4 to 35 °C). Condition material to 65 to 75 °F (18 to 24 °C) before using TECHNICAL INFORMATION 1 / 3 HOLD - 1001 N Van Ness Ave3/7/2025 Shore A Hardness 40±5 (ASTM C-661) Tested at: 73 °F (23 °C) 50 % R.H. Chemical Resistance Good resistance to water, diluted acids, and diluted alkalines. Consult Technical Service for specific data. Resistance to Weathering Excellent Service Temperature -40 to 170 °F (-40 to 77 °C) APPLICATION INFORMATION Coverage 10.1 oz (299 ml) Cartridge: Yield in Linear Feet Depth 1/4"Depth 3/8"Depth 1/2" Width 1/4"24.3 3/8"16.2 10.8 1/2"12.1 8.1 6.1 3/4"8.1 5.4 4.0 1"3.0 1-1/4"2.4 1-1/2"2.0 Ambient Air Temperature 40 to 100 °F (4 to 38 °C). Sealant should be installed when joint is at midrange of its anticipated movement Substrate Temperature 40 to 100 °F (4 to 38 °C). Sealant should be installed when joint is at midrange of its anticipated movement Cure Time Final cure: 5–7 days Tack Free Time 3–6 hours APPLICATION INSTRUCTIONS SUBSTRATE PREPARATION Clean all surfaces. Cracks/Joints must be sound, clean, dry, frost-free, and free of oil and grease. Curing compound residues and any other foreign matter must be thoroughly removed. APPLICATION METHOD / TOOLS Recommended application temperatures: 40 to 100 °F (4 to 38 °C). For cold weather application, condition units at approximately 70 °F (21 °C); remove prior to using. For best performance, Sikaflex® Concrete Fix should be gunned into joint when joint slot is at mid-point of its designed expansion and contraction. Place nozzle of gun into bottom of the joint and fill entire joint. Keep the nozzle in the sealant, continue on with a steady flow of sealant preceding the nozzle to avoid air entrapment. Avoid overlapping of sealant to eliminate entrapment of air. Tool as required. Maximum sealant depth is 1/2 in. (12.7 mm) and width is 1 in. (25.4 mm). Minimum depth is 1/4 (6.3 mm) and width is 1/4 in. (6.3 mm). Proper design is 2:1 width to depth ratio. For use in horizontal joints in traffic areas, the absolute minimum depth of the sealant is 1/2 in. (12.7 mm). Always use bond breaker tape or closed cell backer rod for support on horizontal joints. Tool as necessary, with dry sealant spatula. Uncured material can be removed with approved solvent. Cured material can only be removed mechanically. For spillage, collect, absorb, and dispose of in accordance with current, applicable local, state, and federal regulations. LIMITATIONS Allow 1-week cure at standard conditions when using Sikaflex® Concrete Fix in total water immersion and prior to painting. ▪ When overcoating with water-based, oil-based or rubber-based paints, compatibility and adhesion testing of mock-up installations is essential. ▪ Avoid exposure to high levels of chlorine. (Maximum continuous level is 5ppm of chlorine.) ▪ Maximum depth of sealant must not exceed 1/2 in. (12.7 mm); minimum depth is 1/4 in. (6.35 mm). ▪ Maximum width of sealant must not exceed 1 in. (25.4 ▪ Product Data Sheet Sikaflex® Concrete Fix July 2018, Version 01.02 020511010000000023 2 / 3 HOLD - 1001 N Van Ness Ave3/7/2025 mm). Maximum expansion and contraction should not exceed 35 % of average joint width. ▪ Do not cure in the presence of curing silicone sealants.▪ Avoid contact with alcohol and other solvent cleaners during cure. ▪ Do not apply when moisture-vapor-transmission condition exists from the substrate as this can cause bubbling within the sealant. ▪ To avoid bubbling, do not apply when ambient air and substrate temperatures exceed 100o F (38o C). In extreme summertime conditions, preferably install sealant when ambient air and substrate temperatures are falling. ▪ Use opened cartridges the same day.▪ When applying sealant, avoid air-entrapment.▪ Since system is moisture-cured, permit sufficient exposure to air. ▪ The ultimate performance of Sikaflex® Concrete Fix depends on good joint design and proper application with joint surfaces properly prepared. ▪ Do not tool with detergent or soap solutions.▪ Do not use paints which are silicone based or have a high solvent content. Avoid solvent-based and alcohol- based primers, stains, sealers and coatings. ▪ BASIS OF PRODUCT DATA Results may differ based upon statistical variations depending upon mixing methods and equipment, temperature, application methods, test methods, actual site conditions and curing conditions. OTHER RESTRICTIONS See Legal Disclaimer. ENVIRONMENTAL, HEALTH AND SAFETY For further information and advice regarding transportation, handling, storage and disposal of chemical products, user should refer to the actual Safety Data Sheets containing physical, environmental, toxicological and other safety related data. User must read the current actual Safety Data Sheets before using any products. In case of an emergency, call CHEMTREC at 1-800-424-9300, International 703-527-3887. LEGAL DISCLAIMER • KEEP CONTAINER TIGHTLY CLOSED • KEEP OUT OF REACH OF CHILDREN • NOT FOR INTERNAL CONSUMPTION • FOR INDUSTRIAL USE ONLY • FOR PROFESSIONAL USE ONLY Prior to each use of any product of Sika Corporation, its subsidiaries or affiliates (“SIKA”), the user must always read and follow the warnings and instructions on the product’s most current product label, Product Data Sheet and Safety Data Sheet which are available at usa.sika.com or by calling SIKA’s Technical Service Department at 1-800-933-7452. Nothing contained in any SIKA literature or materials relieves the user of the obligation to read and follow the warnings and instructions for each SIKA product as set forth in the current product label, Product Data Sheet and Safety Data Sheet prior to use of the SIKA product. SIKA warrants this product for one year from date of installation to be free from manufacturing defects and to meet the technical properties on the current Product Data Sheet if used as directed within the product’s shelf life. User determines suitability of product for intended use and assumes all risks. User’s and/or buyer’s sole remedy shall be limited to the purchase price or replacement of this product exclusive of any labor costs. NO OTHER WARRANTIES EXPRESS OR IMPLIED SHALL APPLY INCLUDING ANY WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. SIKA SHALL NOT BE LIABLE UNDER ANY LEGAL THEORY FOR SPECIAL OR CONSEQUENTIAL DAMAGES. SIKA SHALL NOT BE RESPONSIBLE FOR THE USE OF THIS PRODUCT IN A MANNER TO INFRINGE ON ANY PATENT OR ANY OTHER INTELLECTUAL PROPERTY RIGHTS HELD BY OTHERS. Sale of SIKA products are subject to the Terms and Conditions of Sale which are available at https://usa.sika.com/en/group/SikaCorp/termsandconditions.html or by calling 1-800-933-7452. Sika Corporation 201 Polito Avenue Lyndhurst, NJ 07071 Phone: +1-800-933-7452 Fax: +1-201-933-6225 usa.sika.com Sika Mexicana S.A. de C.V. Carretera Libre Celaya Km. 8.5 Fracc. Industrial Balvanera Corregidora, Queretaro C.P. 76920 Phone: 52 442 2385800 Fax: 52 442 2250537 SikaflexConcreteFix-en-US-(07-2018)-1-2.pdf Product Data Sheet Sikaflex® Concrete Fix July 2018, Version 01.02 020511010000000023 3 / 3 HOLD - 1001 N Van Ness Ave3/7/2025