The URL can be used to link to this page

Home My WebLink About2907 S Oak St - PlanSHEET #: G-1 PAINT BOOTH NOTES (CFC 2022- SECTON 24) SHEET CONTENTS: COVER SHEET 2404.1 General The application of flammable or combustible liquids by means of spray apparatus in continuous or intermittent processes shall be in accordance with the requirements of Sections 2403 and 2404.2 through 2404.9.4. 2404.2 Location of Spray-Finishing Operations Spray-finishing operations conducted in buildings used for Group A, E, I or R occupancies shall be located in a spray room protected with an approved automatic sprinkler system installed in accordance with Section 903.3.1.1 and separated vertically and horizontally from the remainder of the building by fire barrier walls and horizontal assemblies with not less than a 1-hour fire-resistance rating in accordance with the California Building Code. In other occupancies, spray-finishing operations shall be conducted in a spray room, spray booth or limited spraying space approved for such use. Exceptions: Automobile undercoating spray operations and spray-on automotive lining operations conducted in areas with approved natural or mechanical ventilation shall be exempt from the provisions of Section 2404 when approved and where utilizing Class IIIA or IIIB combustible liquids. In buildings other than Group A, E, I or R occupancies, approved limited spraying space in accordance with Section 2404.9. Resin application areas used for manufacturing of reinforced plastics complying with Section 2409 shall not be required to be located in a spray room, spray booth or spraying space. 2404.3 Design and Construction Design and construction of spray rooms, spray booths and spray spaces shall be in accordance with Sections 2404.3.1 through 2404.3.4.1. 2404.3.1 Spray Rooms Spray rooms shall be constructed and designed in accordance with Section 416 of the California Building Code and Section 2404.3.2 of this code, and shall comply with Sections 2404.4 through 2404.8 of this code. 2404.3.2 Floor Combustible floor construction in spray rooms shall be covered by approved, noncombustible, nonsparking material, except where combustible coverings, including but not limited to thin paper or plastic and strippable coatings, are utilized over noncombustible materials to facilitate cleaning operations in spray rooms. 2404.3.3 Spray Booths The design and construction of spray booths shall be in accordance with Sections 2404.3.3.1 through 2404.3.3.6, Sections 2404.4 through 2404.8 and NFPA 33. 2404.3.3.1 Construction Spray booths shall be constructed of approved noncombustible materials. Aluminum shall not be used. Where walls or ceiling assemblies are constructed of sheet metal, single-skin assemblies shall be not thinner than 0.0478 inch (18 gage) (1.2 mm) and each sheet of double-skin assemblies shall be not thinner than 0.0359 inch (20 gage) (0.9 mm). Structural sections of spray booths are allowed to be sealed with latex-based or similar caulks and sealants. 2404.3.3.2 Surfaces The interior surfaces of spray booths shall be smooth; shall be constructed so as to permit the free passage of exhaust air from all parts of the interior, and to facilitate washing and cleaning; and shall be designed to confine residues within the booth. Aluminum shall not be used. 2404.3.3.3 Floor Combustible floor construction in spray booths shall be covered by approved, noncombustible, nonsparking material, except where combustible coverings, including but not limited to thin paper or plastic and strippable coatings, are utilized over noncombustible materials to facilitate cleaning operations in spray booths. 2404.3.3.4 Means of Egress Means of egress shall be provided in accordance with Chapter 10. Exception: Means of egress doors from premanufactured spray booths shall be not less than 30 inches (762 mm) in width by 80 inches (2032 mm) in height. 2404.3.3.5 Clear Space Spray booths shall be installed so that all parts of the booth are able to be accessed for cleaning. A clear space of not less than 3 feet (914 mm) shall be maintained on all sides of the spray booth. This clear space shall be kept free of any storage or combustible construction. Exceptions: This requirement shall not prohibit locating a spray booth closer than 3 feet (914 mm) to or directly against an interior partition, wall or floor/ceiling assembly that has a fire-resistance rating of not less than 1 hour, provided that the spray booth can be adequately maintained and cleaned. This requirement shall not prohibit locating a spray booth closer than 3 feet (914 mm) to an exterior wall or a roof assembly, provided that the wall or roof is constructed of noncombustible material and the spray booth can be adequately maintained and cleaned. 2404.3.3.6 Size The aggregate area of spray booths in a building shall not exceed the lesser of 10 percent of the area of any floor of a building or the basic area allowed for a Group H-2 occupancy without area increases, as set forth in the California Building Code. Exception: One individual booth not exceeding 500 square feet (46 m2). 2404.3.4 Spraying Spaces Spraying spaces shall be designed and constructed in accordance with the California Building Code, and Section 2404.3.4.1 and Sections 2404.4 through 2404.8 of this code. 2404.3.4.1 Floor Combustible floor construction in spraying spaces shall be covered by approved, noncombustible, nonsparking material, except where combustible coverings, such as thin paper or plastic and strippable coatings, are utilized over noncombustible materials to facilitate cleaning operations in spraying spaces. 2404.4 Fire Protection Spray booths and spray rooms shall be protected by an approved automatic fire-extinguishing system complying with Chapter 9. Protection shall extend to exhaust plenums, exhaust ducts and both sides of dry filters where such filters are used. 2404.4.1 Fire Extinguishers Portable fire extinguishers complying with Section 906 shall be provided for spraying areas in accordance with the requirements for an extra (high) hazard occupancy. 2404.5 Housekeeping, Maintenance and Storage of Hazardous Materials Housekeeping, maintenance, storage and use of hazardous materials shall be in accordance with Sections 2403.3, 2403.4, 2404.5.1 and 2404.5.2. 2404.5.1 Different Coatings Spray booths, spray rooms and spraying spaces shall not be alternately utilized for different types of coating materials where the combination of materials is conducive to spontaneous ignition, unless all deposits of one material are removed from the booth, room or space and exhaust ducts prior to spraying with a different material. 2404.5.2 Protection of Sprinklers Automatic sprinklers installed in flammable vapor areas shall be protected from the accumulation of residue from spraying operations in an approved manner. Bags used as a protective covering shall be 0.003-inch-thick (0.076 mm) polyethylene or cello-phane or shall be thin paper. Automatic sprinklers contaminated by overspray particles shall be replaced with new automatic sprinklers. 2404.6 Sources of Ignition Control of sources of ignition shall be in accordance with Section 2403.2 and Sections 2404.6.1 through 2404.6.2.4. 2404.6.1 Drying Operations Spray booths and spray rooms shall not be alternately used for the purpose of drying by arrangements or methods that could cause an increase in the surface temperature of the spray booth or spray room except in accordance with Sections 2404.6.1.1 and 2404.6.1.2. Except as specifically provided in this section, drying or baking units utilizing a heating system having open flames or that are capable of producing sparks shall not be installed in a flammable vapor areas. 2404.6.1.1 Spraying Procedure The spraying procedure shall use low-volume spray application. 2404.6.1.2 Drying Apparatus Fixed drying apparatus shall comply with this chapter and the applicable provisions of Chapter 30. Where recirculation ventilation is provided in accordance with Section 2404.7.2, the heating system shall not be within the recirculation air path. 2404.6.1.2.1 Interlocks The spraying apparatus, drying apparatus and ventilating system for the spray booth or spray room shall be equipped with interlocks arranged to accomplish all of the following: Prevent operation of the spraying apparatus while drying operations are in progress. Where the drying apparatus is located in the spray booth or spray room, prevent operation of the drying apparatus until a timed purge of spray vapors from the spray booth or spray room is complete. This purge time shall be based on completing not fewer than four air changes of spray booth or spray room volume or for a period of not less than 3 minutes, whichever is greater. Have the ventilating system maintain a safe atmosphere within the spray booth or spray room during the drying process and automatically shut off drying apparatus in the event of a failure of the ventilating system. Shut off the drying apparatus automatically if the air temperature within the booth exceeds 200°F (93°C). 2404.6.1.2.2 Portable Infrared Apparatus Where a portable infrared drying apparatus is used, electrical wiring and portable infrared drying equipment shall comply with the California Electrical Code. Electrical equipment located within 18 inches (457 mm) of floor level shall be approved for Class I, Division 2, hazardous locations. Metallic parts of drying apparatus shall be electrically bonded and grounded. During spraying operations, portable drying apparatus and electrical connections and wiring thereto shall not be located within spray booths, spray rooms or other areas where spray residue would be deposited thereon. 2404.6.2 Illumination Where spraying spaces, spray rooms or spray booths are illuminated through glass panels or other transparent materials, only fixed luminaires shall be utilized as a source of illumination. 2404.6.2.1 Glass Panels Panels for luminaires or for observation shall be of heat-treated glass, wired glass or hammered wire glass and shall be sealed to confine vapors, mists, residues, dusts and deposits to the flammable vapor area. Panels for luminaires shall be separated from the luminaire to prevent the surface temperature of the panel from exceeding 200°F (93°C). 2404.6.2.2 Exterior Luminaires Luminaires attached to the walls or ceilings of a flammable vapor area, but outside of any classified area and separated from the flammable vapor areas by vapor-tight glass panels, shall be suitable for use in ordinary hazard locations. Such luminaires shall be serviced from outside the flammable vapor areas. 2404.6.2.3 Integral Luminaires Luminaires that are an integral part of the walls or ceiling of a flammable vapor area are allowed to be separated from the flammable vapor area by glass panels that are an integral part of the luminaire. Such luminaires shall be listed for use in Class I, Division 2, or Class II, Division 2, locations, whichever is applicable, and shall be suitable for accumulations of deposits of combustible residues. Such luminaires are allowed to be serviced from inside the flammable vapor area. 2404.6.2.4 Portable Electric Lamps Portable electric lamps shall not be used in flammable vapor areas during spraying operations. Portable electric lamps used during cleaning or repairing operations shall be of a type approved for hazardous locations. 2404.7 Ventilation Mechanical ventilation of flammable vapor areas shall be provided in accordance with Section 502.7 of the California Mechanical Code. 2404.7.1 Operation Mechanical ventilation shall be kept in operation at all times while spraying operations are being conducted and for a sufficient time thereafter to allow vapors from drying coated articles and finishing material residue to be exhausted. Spraying equipment shall be interlocked with the ventilation of the flammable vapor areas such that spraying operations cannot be conducted unless the ventilation system is in operation. 2404.7.2 Recirculation Air exhausted from spraying operations shall not be recirculated. Exceptions: Air exhausted from spraying operations is allowed to be recirculated as makeup air for unmanned spray operations, provided that all of the following conditions exist: The solid particulate has been removed. The vapor concentration is less than 25 percent of the LFL. Approved equipment is used to monitor the vapor concentration. When the vapor concentration exceeds 25 percent of the LFL, both of the following shall occur: An alarm shall sound. Spray operations shall automatically shut down. In the event of shutdown of the vapor concentration monitor, 100 percent of the air volume specified in the California Mechanical Code is automatically exhausted. Air exhausted from spraying operations is allowed to be recirculated as makeup air to manned spraying operations where all of the conditions provided in Exception 1 are included in the installation and documents have been prepared to show that the installation does not pose a life safety hazard to personnel inside the spray booth, spraying space or spray room. 2404.7.3 Air Velocity The ventilation system shall be designed, installed and maintained so that the flammable contaminants are diluted in noncontaminated air to maintain concentrations in the exhaust airflow below 25 percent of the contaminant's lower flammable limit (LFL). In addition, the spray booth shall be provided with mechanical ventilation so that the average air velocity through openings is in accordance with Sections 2404.7.3.1 and 2404.7.3.2. 2404.7.3.1 Open-Face or Open-Front Spray Booth For spray application operations conducted in an open-face or open-front spray booth, the ventilation system shall be designed, installed and maintained so that the average air velocity into the spray booth through all openings is not less than 100 feet per minute (0.51 m/s). Exception: For fixed or automated electrostatic spray application equipment, the average air velocity into the spray booth through all openings shall be not less than 50 feet per minute (0.25 m/s). 2404.7.3.2 Enclosed Spray Booth or Spray Room With Openings for Product Conveyance For spray application operations conducted in an enclosed spray booth or spray room with openings for product conveyance, the ventilation system shall be designed, installed and maintained so that the average air velocity into the spray booth through openings is not less than 100 feet per minute (0.51 m/s). Exceptions: For fixed or automated electrostatic spray application equipment, the average air velocity into the spray booth through all openings shall be not less than 50 feet per minute (0.25 m/s). Where methods are used to reduce cross drafts that can draw vapors and overspray through openings from the spray booth or spray room, the average air velocity into the spray booth or spray room shall be that necessary to capture and confine vapors and overspray to the spray booth or spray room. 2404.7.4 Ventilation Obstruction Articles being sprayed shall be positioned in a manner that does not obstruct collection of overspray. 2404.7.5 Independent Ducts Each spray booth and spray room shall have an independent exhaust duct system discharging to the outside. Exceptions: Multiple spray booths having a combined frontal area of 18 square feet (1.67 m2) or less are allowed to have a common exhaust where identical spray finishing material is used in each booth. If more than one fan serves one booth, fans shall be interconnected such that all fans will operate simultaneously. Where treatment of exhaust is necessary for air pollution control or for energy conservation, ducts shall be allowed to be manifolded if all of the following conditions are met: The sprayed materials used are compatible and will not react or cause ignition of the residue in the ducts. Nitrocellulose-based finishing material shall not be used. A filtering system shall be provided to reduce the amount of overspray carried into the duct manifold. Automatic sprinkler protection shall be provided at the junction of each booth exhaust with the manifold, in addition to the protection required by this chapter. 2404.7.6 Termination Point The termination point for exhaust ducts discharging to the atmosphere shall be not less than the following distances: Ducts conveying explosive or flammable vapors, fumes or dusts: 30 feet (9144 mm) from the lot line; 10 feet (3048 mm) from openings into the building; 6 feet (1829 mm) from exterior walls and roofs; 30 feet (9144 mm) from combustible walls or openings into the building that are in the direction of the exhaust discharge; 10 feet (3048 mm) above adjoining grade. Other product-conveying outlets: 10 feet (3048 mm) from the lot line; 3 feet (914 mm) from exterior walls and roofs; 10 feet (3048 mm) from openings into the building; 10 feet (3048 mm) above adjoining grade. 2404.7.7 Fan Motors and Belts Electric motors driving exhaust fans shall not be placed inside booths or ducts. Fan rotating elements shall be nonferrous or nonsparking or the casing shall consist of, or be lined with, such material. Belts shall not enter the duct or booth unless the belt and pulley within the duct are tightly enclosed. 2404.7.8 Filters Air intake filters that are part of a wall or ceiling assembly shall be listed as Class I or II in accordance with UL 900. Exhaust filters shall be required. 2404.7.8.1 Supports Supports and holders for filters shall be constructed of noncombustible materials. 2404.7.8.2 Attachment Overspray collection filters shall be readily removable and able to be accessed for cleaning or replacement. 2404.7.8.3 Maintaining Air Velocity Visible gauges, audible alarms or pressure-activated devices shall be installed to indicate or ensure that the required air velocity is maintained. 2404.7.8.4 Filter Rolls Spray booths equipped with a filter roll that is automatically advanced when the air velocity is reduced to less than 100 feet per minute (0.51 m/s) shall be arranged to shut down the spraying operation if the filter roll fails to advance automatically. 2404.7.8.5 Filter Disposal Discarded filter pads shall be immediately removed to a safe, detached location or placed in a noncombustible container with a tight-fitting lid and disposed of properly. 2404.7.8.6 Spontaneous Ignition Spray booths using dry filters shall not be used for spraying materials that are highly susceptible to spontaneous heating and ignition. Filters shall be changed prior to spraying materials that could react with other materials previously collected. An example of a potentially reactive combination includes lacquer when combined with varnishes, stains or primers. 2404.7.8.7 Waterwash Spray Booths Waterwash spray booths shall be of an approved design so as to prevent excessive accumulation of deposits in ducts and residue at duct outlets. Such booths shall be arranged so that air and overspray are drawn through a continuously flowing water curtain before entering an exhaust duct to the building exterior. 2404.8 Interlocks Interlocks for spray application finishes shall be in accordance with Sections 2404.8.1 through 2404.8.2. 2404.8.1 Automated Spray Application Operations Where protecting automated spray application operations, automatic fire-extinguishing systems shall be equipped with an approved interlock feature that will, upon discharge of the system, automatically stop the spraying operations and workpiece conveyors into and out of the flammable vapor areas. Where the building is equipped with a fire alarm system, discharge of the automatic fire-extinguishing system shall also activate the building alarm notification appliances. 2404.8.1.1 Alarm Station A manual fire alarm and emergency system shutdown station shall be installed to serve each flammable vapor area. When activated, the station shall accomplish the functions indicated in Section 2404.8.1. 2404.8.1.2 Alarm Station Location Not less than one manual fire alarm and emergency system shutdown station shall be provided with ready access for operating personnel. Where access to this station is likely to involve exposure to danger, an additional station shall be located adjacent to an exit from the area. 2404.8.2 Ventilation Interlock Prohibited Air makeup and flammable vapor area exhaust systems shall not be interlocked with the fire alarm system and shall remain in operation during a fire alarm condition. Exception: Where the type of fire-extinguishing system used requires such ventilation to be discontinued, air makeup and exhaust systems shall shut down and dampers shall close. 2404.9 Limited Spraying Spaces Limited spraying spaces shall comply with Sections 2404.9.1 through 2404.9.4. 2404.9.1 Job Size The aggregate surface area to be sprayed shall not exceed 9 square feet (0.84 m2). 2404.9.2 Frequency Spraying operations shall not be of a continuous nature. 2404.9.3 Ventilation Positive mechanical ventilation providing not fewer than six complete air changes per hour shall be installed. Such system shall meet the requirements of this code for handling flammable vapor areas. Explosion venting is not required. 2404.9.4 Electrical Wiring Electrical wiring within 10 feet (3048 mm) of the floor and 20 feet (6096 mm) horizontally of the limited spraying space shall be designed for Class I, Division 2 locations in accordance with the California Electrical Code. ENGINEER: CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: N.T.S. DATE: 08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO. DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 VICINITY MAP APPLICABLE CODE DATA INSTALL PAINT SPRAY BOOTH: ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 SCOPE OF WORK EQUIPMENT INSTALLATION: 1. INSTALL ONE (1) PAINT SPRAY BOOTH. NOTE: PAINT BOOTH APPROVED BY OCFA UNDER PERMIT #SR 24001435. APPLICABLE CODES: Governing Jurisdiction: Santa Ana, CA City of Santa Ana Municipal Code 2022 California Building Code 2022 California Mechanical Code 2022 California Electrical Code 2022 California Plumbing Code 2022 California Fire Code BUILDING SUMMARY: APN: BUILDING FLOOR AREA: NUMBER OF STORIES: FIRE SPRINKLERS: CONSTRUCTION TYPE: BUILDING HEIGHT: OCCUPANCY TYPE: ZONE: 411-031-02 12,400 SF 1 YES V-B 20'-0" NO CHANGE B / S-1 M1 - LIGHT INDUSTRIAL COVER SHEET / VICINITY MAP / PAINT BOOTH NOTES SITE PLAN & FLOOR PLAN ROOF PLAN & SCREENING PLAN LINE OF SIGHT PAINT SPRAY BOOTH PLAN EQUIPMENT ASSEMBLY & CONSTRUCTION DETAILS GENERAL G-1 ARCHITECTURAL A-1 A-2 A-3 EQUIPMENT Q-1 Q-2 SHEET INDEX BUILDING DATA NOTE: NO HAZARDOUS MATERIALS ARE ALLOWED EXCEEDING THE ALLOWABLE AMOUNT PER TABLE 307.1, CBC 2022. THE FOLLOWING WELDING "WARNING" AND "NO SMOKING" SIGNS SHALL BE POSTED IN THE VICINITY OF SPRAYING AREAS, DIPPING OPERATIONS, AND PAINT STORAGE ROOMS: EQUIPMENT LISTINGS PROJECT LOCATION ETL CERTIFIED, REPORT NO. 103659716CRT-002. OCFA NOTES 1. OCFA FINAL INSPECTION REQUIRED. PLEASE SCHEDULE ALL FIELD INSPECTIONS AT LEAST 48 HOURS IN ADVANCE. INSPECTIONS CANCELED AFTER 1 P.M. ON THE DAY BEFORE THE SCHEDULED DATE WILL BE SUBJECT TO A RE-INSPECTION FEE. CALL OCFA INSPECTION SCHEDULING AT 714-573-6150. 2. SMOKING SHALL BE PROHIBITED IS SPRAY FINISHING AREAS, MIXING ROOMS, AND IN THE VICINITY OF DIP TANKS. “NO SMOKING” SIGNS SHALL BE CONSPICUOUSLY POSTED IN SUCH AREAS. CFC 2403.2.6. 3. WELDING WARNING SIGNS SHALL BE POSTED IN THE VICINITY OF SPRAYING AREAS, DIPPING OPERATIONS, AND PAINT STORAGE ROOMS WITH THE FOLLOWING WARNING: “NO WELDING — THE USE OF WELDING AND/OR CUTTING EQUIPMENT IN OR NEAR THIS AREA IS DANGEROUS BECAUSE OF FIRE AND EXPLOSION HAZARDS. WELDING AND CUTTING SHALL BE DONE ONLY UNDER THE SUPERVISION OF THE PERSON IN CHARGE. ” CFC 2403.2.7. 4. ELECTRICAL WIRING AND EQUIPMENT SHALL BE IN ACCORDANCE WITH CFC 24, NFPA 33, NFPA 70, AND THE CALIFORNIA ELECTRICAL CODE. CFC 2403.2.1. 5. INTERIOR SURFACES OF SPRAY BOOTHS SHALL BE SMOOTH AND CONTINUOUS WITHOUT EDGES AND OTHERWISE DESIGNED TO PREVENT POCKETING OF RESIDUE, TO ALLOW FREE PASSAGE OF EXHAUST AIR FROM ALL POCKETS OF THE INTERIOR, AND TO FACILITATE WASHING AND CLEANING WITHOUT INJURY. CFC 2404.3.2.2. 6. FLOORS SHALL BE OF NONCOMBUSTIBLE MATERIAL OR SHALL BE COVERED WITH A NONCOMBUSTIBLE, NON-SPARKING MATERIAL OF SUCH CHARACTER TO FACILITATE SAFE CLEANING AND REMOVAL OF RESIDUE. CFC 2404.3.1.1. 7. WHEN SPRAY BOOTHS ARE ILLUMINATED, FIXED LIGHTING UNITS THAT TRANSMIT LIGHT INTO THE SPRAY BOOTH THROUGH HEAT-TREATED OR HAMMERED WIRE GLASS SHALL BE USED. GLASS PANELS SHALL BE ARRANGED TO MINIMIZE BREAKAGE AND SO THAT NORMAL ACCUMULATION OF RESIDUE ON THE EXPOSED SURFACE OF A PANEL WILL NOT BE RAISED TO 200OF BY THE HEAT FROM THE SOURCE OF THE ILLUMINATION. CFC 2404.6.2. 8. PORTABLE ELECTRIC LAMPS SHALL NOT BE USED IN SPRAYING AREAS DURING A SPRAYING OPERATION. CFC 2404.6.2.4. 9. METAL PARTS OF SPRAY BOOTHS, EXHAUST DUCTS, AND PIPING SYSTEMS CONVEYING CLASS I OR CLASS II LIQUIDS SHALL BE ELECTRICALLY GROUNDED IN ACCORDANCE WITH THE NATIONAL ELECTRICAL CODE. CFC 2403.2.5. 10. SPRAYING AREAS SHALL BE PROVIDED WITH MECHANICAL VENTILATION ADEQUATE TO PREVENT THE DANGEROUS ACCUMULATION OF VAPORS. CFC 2404.7. 11. MECHANICAL VENTILATION SHALL BE KEPT IN OPERATION AT ALL TIMES WHILE SPRAYING OPERATIONS ARE BEING CONDUCTED AND FOR A SUFFICIENT TIME THEREAFTER TO ALLOW VAPORS FROM DRYING COATED ARTICLES AND FINISHING MATERIAL RESIDUE TO BE EXHAUSTED. CFC 2404.7.1. 12. SPRAYING EQUIPMENT SHALL BE INTERLOCKED WITH THE VENTILATION OF THE SPRAYING AREA SUCH THAT SPRAYING OPERATIONS CANNOT BE CONDUCTED UNLESS THE VENTILATION SYSTEM IS IN OPERATION. CFC 2404.8. 13. AUTOMATIC SPRINKLERS INSTALLED IN FLAMMABLE VAPOR AREAS SHALL BE PROTECTED FROM THE ACCUMULATION OF RESIDUE FROM SPRAYING OPERATIONS IN AN APPROVED MANNER. BAGS USED AS A PROTECTIVE COVERING SHALL BE 0.003-INCH-THICK POLYETHYLENE OR CELLOPHANE OR SHALL BE THIN PAPER. 14. RECIRCULATION VENTILATION SYSTEMS SHALL HAVE APPROVED VAPOR DETECTION SYSTEMS. IF THE APPROVED VAPOR CONCENTRATION IN THE RE-CIRCULATED AIR STREAM EXCEEDS 25 PERCENT OF THE LOWER FLAMMABILITY LIMIT, THE SYSTEM SHALL AUTOMATICALLY SHUT DOWN THE SPRAYING OPERATION, SWITCH THE VENTILATION SYSTEM TO 100 PERCENT OUTDOOR EXHAUST AND SOUND AN ALARM. CFC 2404.7.2. 15. VENTILATION SYSTEMS SHALL BE DESIGNED, INSTALLED AND MAINTAINED SUCH THAT THE AVERAGE AIR VELOCITY OVER THE OPEN FACE OF THE BOOTH, OR BOOTH CROSS-SECTION, IN THE DIRECTION OF AIRFLOW DURING SPRAYING OPERATIONS SHALL NOT BE LESS THAN 100 LINEAL FEET PER MINUTE. CFC 2404.7.3. 16. PORTABLE FIRE EXTINGUISHERS SHALL BE PROVIDED FOR SPRAYING AREAS IN ACCORDANCE WITH THE REQUIREMENTS FOR AN EXTRA (HIGH) HAZARD OCCUPANCY (E.G., 4-A:40-BC WITHIN 30 FEET OF THE BOOTH). SEE CFC STANDARD 10-1. CFC 2404.4.1 AND 906. 17. SPRAY BOOTHS AND SPRAYING ROOMS SHALL NOT BE ALTERNATELY USED FOR THE PURPOSE OF DRYING ARRANGEMENTS WHICH WOULD CAUSE A MATERIAL TO INCREASE THE SURFACE TEMPERATURE OF THE SPRAY BOOTH OR ROOM UNLESS USED FOR AUTOMOBILE REFINISHING IN ACCORDANCE WITH SECTION CFC 2404.6.1 AND 2404.6.1.2.2 18. HOUSEKEEPING, MAINTENANCE, STORAGE AND USE OF HAZARDOUS MATERIALS SHALL BE IN ACCORDANCE WITH SECTIONS 2403.3, 2403.4, 2404.5.1 AND 2404.5.2. 19. WASTE CANS: APPROVED METAL WASTE CANS EQUIPPED WITH SELF-CLOSING LIDS SHALL BE PROVIDED WHENEVER RAGS OR WASTE ARE IMPREGNATED WITH FINISHING MATERIALS. SUCH RAGS AND WASTE SHALL BE DEPOSITED THEREIN IMMEDIATELY AFTER BEING UTILIZED. THE CONTENT OF WASTE CANS SHALL BE PROPERLY DEPOSITED OF AT LEAST ONCE DAILY AND AT THE END OF EACH SHIFT. 20. LIMITED SPRAYING AREAS SHALL BE IN ACCORDANCE WITH CFC 2404.9 AIR MAKEUP AND FLAMMABLE VAPOR AREA EXHAUST SYSTEMS SHALL NOT BE INTERLOCKED WITH THE FIRE ALARM SYSTEM AND SHALL REMAIN IN OPERATION DURING A FIRE ALARM CONDITION. EXCEPTION: SUCH VENTILATION TO BE DISCONTINUED WHERE THE TYPE OF FIRE-EXTINGUISHING SYSTEM USED REQUIRES IT. CFC 2404.8.2. Digitally Signed 03/18/25. Bldg #101122374 Mech #40139973 APPROVALS: PLNG - C. Santana BLDG/MECH - CSG 2907 S Oak St 4/24/2025 OA K S T . ⅊ ⅊ ⅊ NO P A R K I N G (EXIT) (E) ACC R/R (E) LOBBY (E) OFFICE DYER RD. ⅊ (E) SHOP AREA SITE PLAN NOTES: 1. EXHAUST OUTLET TERMINATION POINT TO BE: 30' FROM THE LOT LINE; 10' FROM OPENINGS INTO THE BUILDING; 6' FROM EXTERIOR WALLS AND ROOFS; 10' ABOVE ADJOINING GRADE (PER CFC 2404.7.6) 100' 30' 120' 30'-5" 21'-3"57'-6"21'-3" 16'-6" 8'10' 7'-6" 6'-9" 30'-4" 20'-4" O.H. SHOP DOOR O.H. SHOP DOOR O.H. SHOP DOOR O.H. SHOP DOOR (OUTDOOR AREA) FLOOR PLAN NOTES: 1. ALL WALLS SURROUNDING SPRAY BOOTH ARE 1-HR FIRE RATED. FACTORY INSTALLED PRE-WIRED EQUIPMENT CONTROL PANEL WITH MAIN DISCONNNECT MOUNTED ON EQUIPMENT. BOND CONTROL PANEL TO EQUIPMENT GROUNDING CONDUCTOR. ELECTRICAL KEY NOTES 3/4"C-3#10 & 1#10 GND FOR SPRAY BOOTH TO (E) ELECTRICAL PANEL "A" 2 3 (E) ELECTRICAL SUB-PANEL "LM2" (120/240V, 3Ø, 4W, 200A) 1 4A:60B:C FIRE EXTINGUISHER EXISTING EXTERIOR BLOC WALLS (2-HR FIRE RATED) EXISTING NON-RATED WALLS SYMBOL LEGEND 1 2 3 PROPOSED PAINT BOOTH (SEE SHEET Q-1 FOR PLAN) 19'-7" 2 (E) R/R 38' SHEET #: A-1 SHEET CONTENTS: SITE PLAN & FLOOR PLAN CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: 1" = 20'-0" DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 ENGINEER: Digitally Signed 03/18/25. 2907 S Oak St 4/24/2025 OA K S T . ⅊ ⅊ ⅊ DYER RD. ⅊ 100' 30' 120' 30'-5" 21'-3"57'-6"21'-3" 16'-6" (OUTDOOR AREA) 38' EXHAUST TERMINATION NOTE: EXHAUST OUTLET TERMINATION POINT TO BE: 30' FROM THE LOT LINE; 10' FROM OPENINGS INTO THE BUILDING; 6' FROM EXTERIOR WALLS AND ROOFS; 10' ABOVE ADJOINING GRADE (PER CFC 2404.7.6) - SEE ROOF PLAN SHT. A 2.0 9' 13'-6" 84'-6" 64'-6" 42' 60'-7"73'-11" 100' 46'-11" EXHAUST DUCT SCREENING (SEE PLAN & DETAIL THIS SHEET) (E) ROOFTOP A/C UNIT (E) BLDG. VENT(E) BLDG. VENT (E) BLDG. VENT (E) BLDG. VENT(E) BLDG. VENT SEE PLAN VIEW FOR DISTANCES 6'-0" L2"X2"X14 GA. GALV. STEEL (TYP. OF 3) (E) 2X6 WOOD SUB JOISTS LOCATED @ 24" O.C. (TYP.) TYP. BASE SUPPORT (SEE DETAIL THIS SHEET) TYP. BASE SUPPORT (SEE DETAIL THIS SHEET) TYP. 1 8" NEW 4"X4" WOOD BLOCKING SECURED USING SIMPSON STRONG TIE (LUS44) (TYP.)(E) 4XJOIST/ BEAM SUPPORT Ø5/16" NUT/BOLT CONNECTION (TYP. OF 3) Ø5/16" NUT/BOLT CONNECTION (TYP.) TYP. 1 8" Ø5/16" NUT/BOLT CONNECTION (TYP.) (E) ROOF 16 GA. 4" Z SECTION TO PANELING (ATTACH Z'S USING T/3 TEK SCREWS) 16 GA. 4" Z SECTION TO PANELING (ATTACH Z'S USING T/3 TEK SCREWS) 26 GA. FLAT SHEET METAL SIDING (MATERIAL AND COLOR TO MATCH THAT OF THE EXISTING BUILDING) ROOF SCREENING SECTION DETAIL SCREENING NOTES: 1. DETAIL DEPICTS TYP. CONNECTION OF ROOFFTOP EQUIPMENT SCREENING. 2. CORNER STIFFENERS (TR10) DTL10/RS-5 TO BE PROVIDED @ ALL CORNERS. 3. MATERIAL AND COLOR TO MATCH THAT OF THE EXISTING BUILDING. L4"X4"X1/4" ANGLE IRON PLATE. (TYP.) BASE FLASHINGROOF MEMBRANE (E) PLYWD ROOF DECK FASTEN BASE SUPPORT TO NEW 4X4 WOOD SUPPORT USING Ø5/16"X 4" GRADE 18-8 STAINLESS STEEL HEX HEAD LAG SCREW (TYP. OF ALL BASE CONNECTIONS) L2"X2"X14 GA. (TYP.) 1 8" TYP. Ø5/16" NUT/BOLT CONNECTION (TYP.) NEW 4"X4" WOOD BLOCKING SECURED USING SIMPSON STRONG TIE (LUS44) (TYP.) BASE SUPPORT DETAIL ROOF SCREENING PLAN VIEW 9' 4'-6"2'-3"2'-3" 4'-6" 4'-5" 4'-6" 13'-6" -- 2TYP. -- 2 TYP. Ø42" DUCT 6'-9" 6'-9" 3'4'-6" (EXISTING PARAPET WALL) (E X I S T I N G P A R A P E T W A L L ) (EXISTING PARAPET WALL) (E X I S T I N G P A R A P E T W A L L ) 20' SHEET #: A-2 SHEET CONTENTS: ROOF PLAN & SCREENING PLAN CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: 1" = 20'-0" DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 ENGINEER: Digitally Signed 03/18/25. 2907 S Oak St 4/24/2025 6' DYER RD. 300' (2907 OAK ST, SANTA ANA, CA 92707) LINE OF SIGHT (N)EXHAUST DUCT W/ SCREENING 120'16'-6" 20' 4' 2' (E) OTHER BUILDING SHEET #: A-3 SHEET CONTENTS: LINE OF SIGHT CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: 1" = 20'-0" DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 ENGINEER: Digitally Signed 03/18/25. 2907 S Oak St 4/24/2025 333 333 333 333 4 Dwyer 6 4 26'-4"3'-6" 30'-4" 20 ' 20 ' - 4 " 26'-4"3'-6" 30'-4" 11 ' 11 ' - 2 " 20' 20'-4" 11 ' 11 ' - 2 " PLAN VIEW RIGHT SIDE VIEW FRONT VIEW 1 2 25 5 2 1 1 (EXHAUST AIR)(EXHAUST AIR) 5 5 55 333 333 SHEET #: Q-1 SHEET CONTENTS: AUTOMOTIVE PAINT SPRAY BOOTH PLAN EQUIPMENT ANCHORAGE & ASSEMBLY NOTES: 1. EQUIPMENT TO BE ANCHORED TO (E) CONCRETE FLOOR USING APPROVED ICC-ESR ANCHOR BOLTS (SEE DETAIL #1, SHEET Q-2). 2. EQUIPMENT WALL AND ROOF PANELS CONSTRCUTED OF 18 GA. GALV. STEEL (ASTM-A653,G90) PER CFC 2022, SEC. 2404.3.2.1. (SEE DETAILS #1-4, SHEET Q-2). 3. EQUIMENT PANEL ASSEMBLY BOLTAGE: ALL EQUIPMENT PANELS ARE CONSTRUCTED OF 18 GA. GALV. STEEL (BOLTS: ASTM A325, TYPE 1; HEX NUT: ASTM A563) (SEE DETAILS #1-5, SHEET Q-2 FOR PANEL TO PANEL ASSEMBLY). NOTE: SPECIAL INSPECTION REQUIRED FOR POST INSTALLED ANCHORS. 4. FOR EQUIPMENT DUCT PENETRATION THROUGH ROOF SEE DETAILS #9-10, SHEET Q-2). Ø42" EXHAUST FAN UNIT (DAYTON 7F871, CFM @ 0.250-In. SP=25,320 CFM) DRIVEN BY (1) 5HP ODP TYPE MOTOR W/ A MIN.18 GA GALVANIZED STEEL EXHAUST DUCT DESCRIPTION 2 QTY. 2 PAINT SPRAY BOOTH EQUIPMENT SCHEDULE EXHAUST PLENUM W/ (70) 20"X20"X2" REAR EXHAUST FILTERS 1 EXHAUST AIR FAN EQUIPMENT TYPE EXHAUST PLENUM AREA ITEM 2 18 1 1 1 (3060) DOUBLE-SIDED POWDER COATED EQUIPPED W/ CLEAR TEMPERED GLASS WINDOWPERSONNELL ACCESS DOOR 4-TUBE 32 WATT T8 FIXTURES, 115 VOLTS, POLISHED ALUMINUM MIRRORED REFLECTORS (CLASS1 DIV 1 OR 2 WHERE APPLICABLE)LIGHTING FIXTURES3 4 5 6 QUAD-FOLD ENTRY DOORS (16'WX11'H) EQUIPPED W/ (48) INTAKE AIR FILTERS, DOOR INTERLOCKSSPRAY BOOTH ENTRY DOORS MFR.: DWYER, MODEL: MARK II 25 - RANGE 0-3" W.C.. RED OIL, .26 SP. GR.MANOMETER MECHANICAL NOTES: 1. THE MECHANICAL SYSTEM SHALL BE INTERLOCKED WITH THE SPRAYING OPERATION SO THAT SPRAYING WILL NOT OCCUR UNLESS THE VENTILATION SYSTEM IS OPERATING PROPERLY. SPRAY BOOTH AIR VELOCITY (PER CFC 2404.7.3): SPRAY BOOTH CROSS-SECTION AREA: 20'X11' = 220 S.F. SPRAY BOOTH AIR VELOCITY REQUIRED: 220 S.F. X 100 (LFM) = 22,000 CFM SPRAY BOOTH AIR VELOCITY PROVIDED: 25,320 CFM (OK) CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: N.T.S. DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 2907 S Oak St 4/24/2025 2" 5/8" 1 EQUIPMENT ANCHORING DETAIL 2 EQUIPMENT SIDE PANEL TO SIDE PANEL DETAIL 3 SIDE PANEL TO ROOF PANEL DETAIL 4 EQUIPMENT CORNER PANEL ASSEMBLY DETAIL 5/16" X3/4" NUT AND BOLT, 6" O.C.. 18 GA GALV. STEEL PANELS ALL SEAMS TO BE CAULKED 18 GA GALV. STEEL ROOF PANEL 18 GA GALV. STEEL SIDE PANEL ALL SEEMS TO BE CAULKED 5/16" X3/4" NUT AND BOLT, 6" O.C. Z-BAR 5/16" x 3/4" NUT AND BOLT, 6" O.C. 18 GA. GALV. STEEL SIDE PANEL 18 GA GALV. STEEL ROOF PANEL ALL SEEMS TO BE CAULKED 6 MANOMETER DETAIL 5 EQUIPMENT LIGHTING MOUNT DETAIL 7 ARTICLE 516 TOP VIEW 8 ARTICLE 516 ELEVATION VIEW 10 DUCT PENETRATION THROUGH ROOF DETAIL 9 TYP. DUCT ASSEMBLY & ROOF PENETRATION DETAIL 5/16" x 3/4" NUT AND BOLT, 6" O.C. 4 LIGHT TUBE FIXTURE 18 GA GALV. STEEL PANEL MOUNTING FRAME 18 GA GALV. STEEL 18 GA GALV. STEEL PANEL 1/2" x 3/8" FOAM GASKET Dwyer RUN RUBBER TUBING FROM HIGH TO BRASS FITTING IN SPRAY AREA WALL SLOWLY FILL WITH RED OIL UNTIL IT APPEARS IN GAGE CALIBRATE UNTIL MENISCUS REACHES ZERO RUN RUBBER TUBING FROM LOW TO BRASS FITTING IN EXHAUST CHAMBER WALL MANOMETER TO BE MOUNTED ON WALL PANEL SEE ELEVATION FOR PLACEMENT LEVELING VIAL RECOMMEND ARRESTOR CHANGE AT .3 INCHES OF WATER 5 FT. R (915 MM) ENCLOSED SPRAY BOOTH OR ROOM (CLASS I, DIVISION I OR CLASS II, DIVISION I WITHIN) 3 ft. R 3 ft. R CLASS I OR CLASS II, DIVISION 2. LOCATION ADJACENT TO OPENINGS IN AN ENCLOSED SPRAY BOOTH OR ROOM 5 FT. R (915 MM) EXTEND OF CLASS I OR CLASS II, DIVISION 2 AREA 5 FT. R (915 MM) 3 FT. R (915 MM) 3 FT. R (915 MM) 3 FT. R (915 MM) STACK CAP 20. GA. GALVANIZED STEEL SECURITY BARS TO BE INSTALLED IN DUCT DUCT 20 GA. GALVANIZED STEEL ROOF JACK FLASHING 2X FRAMING SUPPORTS (TYP.) FIRE SPRINKLERS DOOR TO BE PROVIDED BY CMC 2022, 506.6 13" X 15" CLEAN OUT DOOR W/ LATCH REQUIRED AT SPRINKLER HEAD LOCATION 20 GA. GALVANIZED STEEL @ 10'O.C. PER CMC 506.3 INSULATED THIMBLE CONSIST OF 24 GA. SHEET METAL OVER 1" GLASS FIBER REINFORCED W/ WIRE ON REAR FACE W/ A 2" AIR GAP (PER CMC 2022, 506.7) ROOF JACK STACK EXHAUST OUTLET TERMINATION POINT SHALL BE 6' MIN. ABOVE ROOF AND 10' MIN. FROM ANY OPEN'G IN THE BUILDING PER 2022 CFC SECTION 2404.7.6 18 " 18 " 10 - Ø42" FAN TUBEAXIAL EXHAUT FAN (SEE EQUIPMENT SCHEDULE FOR SPECS) 3" CLEARANCE ALL AROUND DUCT ROOF SEALANT (ALL AROUND-TYP.) 6" 5/16" x 3/4" NUT AND BOLT, 6" O.C. POWER BULL WEDGE ANCHORS Ø3/8" X 3" W/ 2" EMBEDMN'T @ 36" O.C. (ESR-2254) SIDE PANEL 18 GA GALV. STEEL FLOOR RAIL 14 GA. GALV. STEEL (E) 6" CONCRETE SLAB NEW 2 x 4 SUB- MEMBERS (TYP. OF 4 LOCATIONS) NEW 2 x 4 MEMBER TO REINFORCE JOIST DOUBLE JOIST SUPPORTS (2x4) SIMPSON STRONG TIE LU-24 ESR 3096 (TYP.) NOTE: ALL NAILING OF 2X4 MEMBERS TO BE 2-16d COMMONS @ 6" O.C. INSULATED THIMBLE W/ 2" AIR GAP (PER CMC 2022, 506.7) EXISTING 2x4 SUB-MEMBERS 14 GA. DUCT CLIP ATTACHED TO DUCT TO SECURE- STABILIZE DUCT@ ROOF LINE (TYP.) NEW 2 x 4 MEMBER TO REINFORCE JOIST EXISTING 2 x 4 SUB-MEMBERS DOUBLE JOIST SUPPORTS (2x4) SIMPSON STRONG TIE LU-24 ESR 3096 (TYP.) NOTE: ALL NAILING OF 2X4 MEMBERS TO BE 2-16d COMMONS @ 6" O.C. Ø42" DUCT NOTES: 1. SPACERS AND TIES FOR PROTECTION MATERIALS SHALL BE OF NONCOMBUSTIBLE MATERIAL AND SHALL NOT BE USED DIRECTLY BEHIND THE DUCT PER CMC 2022 SECTION 506.7.1. 2. SPACING OF SUPPORTS FOR DUCTS SHALL NOT EXCEED TWELVE (12) FEET (3,658 MM) FOR EIGHT (8) INCH (203 MM) DUCTS NOR TWENTY (20) FEET (6,096 MM FOR LARGER DUCT, UNLESS JUSTIFIED BY THE DESIGN. LOADS SHALL NOT BE PLACED ON CONNECTING EQUIPMENT PER CMC 2022, 506.5. 3. ALL DUCTWORK AND SYSTEM COMPONENTS HANDLING COMBUSTIBLE MATERIAL AND OPERATING AT LESS THAN 140°F SHALL HAVING A CLEARANCE OF NOT LESS THAN EIGHTEEN (18) INCHES FROM COMBUSTIBLE CONSTRUCTION OR ANY COMBUSTIBLE MATERIAL. NOTE: ALL COMBUSTIBLE CONSTRUCTION WITHIN (18) INCHES OF DUCT SHALL BE PROTECTED USING (NO. 24 GA.) SHEET METAL WITH NOT LESS THAN A ONE INCH AIR GAP. THE PRESCRIPTIVE MATERIAL IS APPLIED TO THE COMBUSTIBLE CONSTRUCTION INCLUDING THE WALL AND CEILING AREA PER CMC SECTION 506.7. OPENING SIZE VARIES PER DUCT SIZE 1" CLEAR SPACE 3" SHEET #: Q-2 SHEET CONTENTS: EQUIPMENT ASSEMBLY & DETAILS CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: N.T.S. DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 2907 S Oak St 4/24/2025 333 333 333 333 4 4 30'3'-6" 34' 30' 34' 11 ' 11 ' - 2 " 20' 20'-4" 11 ' 11 ' - 2 " PLAN VIEW RIGHT SIDE VIEW FRONT VIEW 1 2 5 5 1 1 (EXHAUST AIR)(EXHAUST AIR) 5 5 55 333 333 20 ' 20 ' - 4 " 2 2 Dwyer 6 Dwyer 6 Dwyer 6 3'-6" SHEET #: Q-1 SHEET CONTENTS: AUTOMOTIVE PAINT SPRAY BOOTH PLAN EQUIPMENT ANCHORAGE & ASSEMBLY NOTES: 1. EQUIPMENT TO BE ANCHORED TO (E) CONCRETE FLOOR USING APPROVED ICC-ESR ANCHOR BOLTS (SEE DETAIL #1, SHEET Q-2). 2. EQUIPMENT WALL AND ROOF PANELS CONSTRCUTED OF 18 GA. GALV. STEEL (ASTM-A653,G90) PER CFC 2022, SEC. 2404.3.2.1. (SEE DETAILS #1-4, SHEET Q-2). 3. EQUIMENT PANEL ASSEMBLY BOLTAGE: ALL EQUIPMENT PANELS ARE CONSTRUCTED OF 18 GA. GALV. STEEL (BOLTS: ASTM A325, TYPE 1; HEX NUT: ASTM A563) (SEE DETAILS #1-5, SHEET Q-2 FOR PANEL TO PANEL ASSEMBLY). NOTE: SPECIAL INSPECTION REQUIRED FOR POST INSTALLED ANCHORS. 4. FOR EQUIPMENT DUCT PENETRATION THROUGH ROOF SEE DETAILS #9-10, SHEET Q-2). Ø42" EXHAUST FAN UNIT (DAYTON 7F871, CFM @ 0.250-In. SP=25,320 CFM) DRIVEN BY (1) 5HP ODP TYPE MOTOR W/ A MIN.18 GA GALVANIZED STEEL EXHAUST DUCT DESCRIPTION 2 QTY. 2 PAINT SPRAY BOOTH EQUIPMENT SCHEDULE 1 EXHAUST AIR FAN EQUIPMENT TYPE EXHAUST PLENUM AREA ITEM 2 18 1 1 1 (3060) DOUBLE-SIDED POWDER COATED EQUIPPED W/ CLEAR TEMPERED GLASS WINDOWPERSONNELL ACCESS DOOR 4-TUBE 32 WATT T8 FIXTURES, 115 VOLTS, POLISHED ALUMINUM MIRRORED REFLECTORS (CLASS1 DIV 1 OR 2 WHERE APPLICABLE)LIGHTING FIXTURES3 4 5 6 QUAD-FOLD ENTRY DOORS (16'WX11'H) EQUIPPED W/ (48) INTAKE AIR FILTERS, DOOR INTERLOCKSSPRAY BOOTH ENTRY DOORS MFR.: DWYER, MODEL: MARK II 25 - RANGE 0-3" W.C.. RED OIL, .26 SP. GR.MANOMETER MECHANICAL NOTES: 1. THE MECHANICAL SYSTEM SHALL BE INTERLOCKED WITH THE SPRAYING OPERATION SO THAT SPRAYING WILL NOT OCCUR UNLESS THE VENTILATION SYSTEM IS OPERATING PROPERLY. SPRAY BOOTH AIR VELOCITY (PER CFC 2404.7.3): SPRAY BOOTH CROSS-SECTION AREA: 20'X11' = 220 S.F. SPRAY BOOTH AIR VELOCITY REQUIRED: 220 S.F. X 100 (LFM) = 22,000 CFM SPRAY BOOTH AIR VELOCITY PROVIDED: 25,320 CFM (OK) CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: N.T.S. DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 EXHAUST PLENUM W/ 3-STAGE FILTRATION, INCLUDING (70) EXHAUST PRE-EXHAUST FILTERS, (70) EXHAUST POCKET EXHAUST FILTERS, AND (70) FINAL EXHAUST CARBON FILTERS ENGINEER: Digitally Signed 03/18/25. 2907 S Oak St 4/24/2025 2" 5/8" 1 EQUIPMENT ANCHORING DETAIL 2 EQUIPMENT SIDE PANEL TO SIDE PANEL DETAIL 3 SIDE PANEL TO ROOF PANEL DETAIL 4 EQUIPMENT CORNER PANEL ASSEMBLY DETAIL 5/16" X3/4" NUT AND BOLT, 6" O.C.. 18 GA GALV. STEEL PANELS ALL SEAMS TO BE CAULKED 18 GA GALV. STEEL ROOF PANEL 18 GA GALV. STEEL SIDE PANEL ALL SEEMS TO BE CAULKED 5/16" X3/4" NUT AND BOLT, 6" O.C. Z-BAR 5/16" x 3/4" NUT AND BOLT, 6" O.C. 18 GA. GALV. STEEL SIDE PANEL 18 GA GALV. STEEL ROOF PANEL ALL SEEMS TO BE CAULKED 6 MANOMETER DETAIL 5 EQUIPMENT LIGHTING MOUNT DETAIL 7 ARTICLE 516 TOP VIEW 8 ARTICLE 516 ELEVATION VIEW 10 DUCT PENETRATION THROUGH ROOF DETAIL 9 TYP. DUCT ASSEMBLY & ROOF PENETRATION DETAIL 5/16" x 3/4" NUT AND BOLT, 6" O.C. 4 LIGHT TUBE FIXTURE 18 GA GALV. STEEL PANEL MOUNTING FRAME 18 GA GALV. STEEL 18 GA GALV. STEEL PANEL 1/2" x 3/8" FOAM GASKET Dwyer RUN RUBBER TUBING FROM HIGH TO BRASS FITTING IN SPRAY AREA WALL SLOWLY FILL WITH RED OIL UNTIL IT APPEARS IN GAGE CALIBRATE UNTIL MENISCUS REACHES ZERO RUN RUBBER TUBING FROM LOW TO BRASS FITTING IN EXHAUST CHAMBER WALL MANOMETER TO BE MOUNTED ON WALL PANEL SEE ELEVATION FOR PLACEMENT LEVELING VIAL RECOMMEND ARRESTOR CHANGE AT .3 INCHES OF WATER 5 FT. R (915 MM) ENCLOSED SPRAY BOOTH OR ROOM (CLASS I, DIVISION I OR CLASS II, DIVISION I WITHIN) 3 ft. R 3 ft. R CLASS I OR CLASS II, DIVISION 2. LOCATION ADJACENT TO OPENINGS IN AN ENCLOSED SPRAY BOOTH OR ROOM 5 FT. R (915 MM) EXTEND OF CLASS I OR CLASS II, DIVISION 2 AREA 5 FT. R (915 MM) 3 FT. R (915 MM) 3 FT. R (915 MM) 3 FT. R (915 MM) STACK CAP 20. GA. GALVANIZED STEEL SECURITY BARS TO BE INSTALLED IN DUCT DUCT 20 GA. GALVANIZED STEEL ROOF JACK FLASHING 2X FRAMING SUPPORTS (TYP.) FIRE SPRINKLERS DOOR TO BE PROVIDED BY CMC 2022, 506.6 13" X 15" CLEAN OUT DOOR W/ LATCH REQUIRED AT SPRINKLER HEAD LOCATION 20 GA. GALVANIZED STEEL @ 10'O.C. PER CMC 506.3 INSULATED THIMBLE CONSIST OF 24 GA. SHEET METAL OVER 1" GLASS FIBER REINFORCED W/ WIRE ON REAR FACE W/ A 2" AIR GAP (PER CMC 2022, 506.7) ROOF JACK STACK EXHAUST OUTLET TERMINATION POINT SHALL BE 6' MIN. ABOVE ROOF AND 10' MIN. FROM ANY OPEN'G IN THE BUILDING PER 2022 CFC SECTION 2404.7.6 18 " 18 " 10 - Ø42" FAN TUBEAXIAL EXHAUT FAN (SEE EQUIPMENT SCHEDULE FOR SPECS) 3" CLEARANCE ALL AROUND DUCT ROOF SEALANT (ALL AROUND-TYP.) 6" 5/16" x 3/4" NUT AND BOLT, 6" O.C. POWER BULL WEDGE ANCHORS Ø3/8" X 3" W/ 2" EMBEDMN'T @ 36" O.C. (ESR-2254) SIDE PANEL 18 GA GALV. STEEL FLOOR RAIL 14 GA. GALV. STEEL (E) 6" CONCRETE SLAB NEW 2 x 4 SUB- MEMBERS (TYP. OF 4 LOCATIONS) NEW 2 x 4 MEMBER TO REINFORCE JOIST DOUBLE JOIST SUPPORTS (2x4) SIMPSON STRONG TIE LU-24 ESR 3096 (TYP.) NOTE: ALL NAILING OF 2X4 MEMBERS TO BE 2-16d COMMONS @ 6" O.C. INSULATED THIMBLE W/ 2" AIR GAP (PER CMC 2022, 506.7) EXISTING 2x4 SUB-MEMBERS 14 GA. DUCT CLIP ATTACHED TO DUCT TO SECURE- STABILIZE DUCT@ ROOF LINE (TYP.) NEW 2 x 4 MEMBER TO REINFORCE JOIST EXISTING 2 x 4 SUB-MEMBERS DOUBLE JOIST SUPPORTS (2x4) SIMPSON STRONG TIE LU-24 ESR 3096 (TYP.) NOTE: ALL NAILING OF 2X4 MEMBERS TO BE 2-16d COMMONS @ 6" O.C. Ø42" DUCT NOTES: 1. SPACERS AND TIES FOR PROTECTION MATERIALS SHALL BE OF NONCOMBUSTIBLE MATERIAL AND SHALL NOT BE USED DIRECTLY BEHIND THE DUCT PER CMC 2022 SECTION 506.7.1. 2. SPACING OF SUPPORTS FOR DUCTS SHALL NOT EXCEED TWELVE (12) FEET (3,658 MM) FOR EIGHT (8) INCH (203 MM) DUCTS NOR TWENTY (20) FEET (6,096 MM FOR LARGER DUCT, UNLESS JUSTIFIED BY THE DESIGN. LOADS SHALL NOT BE PLACED ON CONNECTING EQUIPMENT PER CMC 2022, 506.5. 3. ALL DUCTWORK AND SYSTEM COMPONENTS HANDLING COMBUSTIBLE MATERIAL AND OPERATING AT LESS THAN 140°F SHALL HAVING A CLEARANCE OF NOT LESS THAN EIGHTEEN (18) INCHES FROM COMBUSTIBLE CONSTRUCTION OR ANY COMBUSTIBLE MATERIAL. NOTE: ALL COMBUSTIBLE CONSTRUCTION WITHIN (18) INCHES OF DUCT SHALL BE PROTECTED USING (NO. 24 GA.) SHEET METAL WITH NOT LESS THAN A ONE INCH AIR GAP. THE PRESCRIPTIVE MATERIAL IS APPLIED TO THE COMBUSTIBLE CONSTRUCTION INCLUDING THE WALL AND CEILING AREA PER CMC SECTION 506.7. OPENING SIZE VARIES PER DUCT SIZE 1" CLEAR SPACE 3" SHEET #: Q-2 SHEET CONTENTS: EQUIPMENT ASSEMBLY & DETAILS CLIENT: PROJECT: INSTALL PAINT SPRAY BOOTH CONTRACTOR: REVISIONS SCALE: N.T.S. DATE:08/24/24 CHECKED BY: M.M. DRAWN BY: P. A. NO.DESCRIPTION DATE ADVANCED FIBERGLASS CONCEPTS 2907 OAK ST. SANTA ANA, CA 92707 WARNING: This document is for the use of licensed users only. Any Unauthorized copying, distribution, or disclosure of information is a violation of copyright laws. No reproduction in whole or in part of this document may be made without the written consent of MDI Spray Systems. MDI Spray Systems 888 E. 1st Street Pomona, CA 91766 www.mdispraysystems.com LIC.#499372, CLASS B, C-16 EXPIRES: 05/31/25 ENGINEER: Digitally Signed 03/18/25. 2907 S Oak St 4/24/2025 z^EK ,16758&7,216 25$1*( &2817< ),5( $87+25,7< 3ODQ6XEPLWWDO&ULWHULD &200(5&,$/SURMHFWV08/7,)$0,/<5(6,'(17,$/SURMHFWV DQG5(6,'(17,$/75$&7GHYHORSPHQWV )LOOLQWKHSURMHFWEXVLQHVVDGGUHVVDQGSURYLGHDEULHIGHVFULSWLRQRIWKHVFRSHRIZRUNDQGW\SHRIEXVLQHVVRSHUDWLRQWKDWZLOOWDNHSODFH $QVZHUTXHVWLRQVWKURXJKUHDGDQGLQLWLDOLWHPVDQGWKHQFRPSOHWHDQGVLJQWKHFHUWLILFDWLRQVHFWLRQ ,I\RXDQVZHU³<(6´WRDQ\SDUWRITXHVWLRQVWKURXJKVXEPLWWKHW\SHRISODQLQGLFDWHGLQLWDOLFVWR2&)$ ,QVRPHFDVHVRWKHUSODQW\SHVQRWLQGLFDWHGKHUHLQPD\DOVREHQHFHVVDU\GHSHQGLQJRQVSHFLILFFRQGLWLRQVRURSHUDWLRQV 9LVLWZZZRFIDRUJIRUVXEPLWWDOLQIRUPDWLRQDQGORFDWLRQV,I\RXQHHGDVVLVWDQFHLQILOOLQJRXWWKLVIRUPRUKDYHTXHVWLRQVUHJDUGLQJ UHTXLUHPHQWVIRUUHYLHZSOHDVHFRQWDFW2&)$DWRUYLVLWXVDW)LUH$XWKRULW\5RDG,UYLQH&$ $GGUHVV6XLWH&LW\ 3URMHFW6FRSH%XVLQHVV'HVFULSWLRQ &RQVWUXFWLRQRIDQHZEXLOGLQJDQHZVWRU\RULQFUHDVHWKHIRRWSULQWRIDQH[LVWLQJEXLOGLQJ" &KDQJHVWRURDGZD\V FXUEVRU GULYH DLVOHV" $GGLWLRQ UHORFDWLRQRU PRGLILFDWLRQ RI ILUH K\GUDQWV RUIHQFHVJDWHV" &RQVWUXFWLRQ ZLWKLQ IHHWRIDQDFWLYHRUSURSRVHGRLOZHOO")LUH0DVWHU3ODQ35 3URSHUW\LVDGMDFHQWWRDZLOGODQGDUHDRUQRQLUULJDWHGQDWLYHYHJHWDWLRQ" )LUH0DVWHU3ODQ35D)XHO0RGLILFDWLRQ3ODQPD\DOVREHUHTXLUHG3535 /RFDWHGLQRU¶IURPD'LYLVLRQRI2LO*DVDQG*HRWKHUPDO5HVRXUFHV'2**5ILHOGERXQGDU\¶IURP DQRLOJDVVHHSRU¶IURPDODQGILOO"0HWKDQH:RUN3ODQ35 ,QVWDOODWLRQPRGLILFDWLRQUHSDLURIXQGHUJURXQGSLSLQJEDFNIORZSUHYHQWHUVRUILUHGHSDUWPHQWFRQQHFWLRQVVHUYLQJ SULYDWHILUHK\GUDQWVSULQNOHUVWDQGSLSHV\VWHPV"8QGHUJURXQG3ODQ3535 'ULQNLQJGLQLQJUHFUHDWLRQPHHWLQJVWUDLQLQJUHOLJLRXVIXQFWLRQVRURWKHUJDWKHULQJVLQDURRP!VTIW! VTIWIRUWUDLQLQJDGXOWHGXFDWLRQRU!SHRSOH"+HDOWKFDUHRXWSDWLHQWVHUYLFHVIRU!SHRSOHZKRPD\EHXQDEOH WRLPPHGLDWHO\HYDFXDWHZLWKRXWDVVLVWDQFH"(GXFDWLRQIRUFKLOGUHQDFDGHPLFWXWRULQJIRUDJHVLVH[HPSWXQOHVV FODVVLILHGDVDQ(RFFXSDQF\E\WKH%XLOGLQJ2IILFLDO"$GXOWFKLOGGD\FDUH"KRXUFDUHVXSHUYLVLRQ",QFDUFHUDWLRQ RU UHVWUDLQW" +RWHODSDUWPHQW RU UHVLGHQWLDO IDFLOLW\ ZLWK XQLWV DQG VWRULHV VWRU\ WRZQKRXVHVURZKRXVHV ZKHUHDQLQGHSHQGHQWGLUHFWH[LWWRJUDGHLVSURYLGHGIRUGZHOOLQJDUHH[HPSW"&RQJUHJDWHKRXVLQJGRUPLWRULHV ZLWKSHRSOH" +LJKULVHVWUXFWXUHIHHWWRKLJKHVWRFFXSLHGIORRUOHYHO"$UFKLWHFWXUDO3ODQ3535 ,QVWDOODWLRQPRGLILFDWLRQRIORFNVGHOD\LQJRUSUHYHQWLQJRFFXSDQWVIURPOHDYLQJDVSDFHRUUHTXLULQJXVHRIDFDUG EXWWRQ RU VLPLODU DFWLRQ WR RSHQ D GRRU LQ WKH GLUHFWLRQ RI H[LW WUDYHO"$UFKLWHFWXUDO 6SULQNOHU DQGRU $ODUP 3ODQ GHSHQGLQJRQWKHRFFXSDQF\DQGW\SHRIGHYLFHLQVWDOOHG353535353535 ,QVWDOODWLRQPRGLILFDWLRQXVH RI VSUD\ ERRWKV GXVW FROOHFWLRQ GU\ FOHDQLQJ LQGXVWULDO RYHQVGU\LQJ HTXLSPHQW LQGXVWULDOFRPPHUFLDO UHIULJHUDWLRQ V\VWHPV FRPSUHVVHG JDVVHV WDQNV IRU FU\RJHQLF RU IODPPDEOHFRPEXVWLEOH OLTXLGVYDSRUUHFRYHU\VPRNHFRQWUROEDWWHU\EDFNXSFKDUJLQJV\VWHPV!JDOHOHFWURO\WH!OEOLWKLXP LRQZHOGLQJEUD]LQJVROGHULQJRSHQIODPHWRUFKHVFXWWLQJJULQGLQJRURWKHUVLPLODURSHUDWLRQV" 6SHFLDO(TXLSPHQW3ODQ353535 6WRUDJHXVHUHVHDUFK ZLWK IODPPDEOHFRPEXVWLEOH OLTXLGV RU RWKHU FKHPLFDOV" 0RWRU YHKLFOHDLUFUDIW PDLQWHQDQFHUHSDLU"&DELQHWU\ZRRGZRUNLQJILQLVKLQJ IDFLOLW\"&KHP &ODVV IORRU SODQ IXOO DUFKLWHFWXUDO SODQ LI +RFFXSDQF\6SHFLDO(TXLSPHQW3ODQVPD\EHQHFHVVDU\35353535 6WRUDJHRUPHUFKDQGL]LQJDUHDVLQH[FHVVRIVTIWZKHUHLWHPVDUHORFDWHGKLJKHUWKDQ¶¶IRUKLJKKD]DUG FRPPRGLWLHVSODVWLFUXEEHUIRDPHWF"+LJKSLOHG6WRUDJH3ODQ35 &RRNLQJXQGHUD7\SH,FRPPHUFLDOKRRGLQVWDOODWLRQRUPRGLILFDWLRQRIDILUHH[WLQJXLVKLQJV\VWHPORFDWHGLQD FRPPHUFLDOFRRNLQJKRRG"+RRG 'XFW([WLQJXLVKLQJ6\VWHPQRWMXVWWKHKRRGPHFKDQLFDOSODQ35 ,QLWLDOHDFKRIWKHIROORZLQJWZRLWHPVLQGLFDWLQJWKDW\RXKDYHUHDGDQGXQGHUVWDQGWKHVWDWHPHQW 6SULQNOHUV$ODUPV &RQVXOW %XLOGLQJ)LUH &RGHV DQG RUGLQDQFHV WR GHWHUPLQH VSULQNOHUDODUP UHTXLUHPHQWV LI D V\VWHP LV UHTXLUHGSODQVVKDOOEHVXEPLWWHGIRU2&)$UHYLHZ([LVWLQJEXLOGLQJVXQGHUJRLQJUHPRGHOPXVWEHHYDOXDWHGE\DOLFHQVHG /ŶŝƚŝĂůƐFRQWUDFWRUWRGHWHUPLQHLIPRGLILFDWLRQLVQHHGHGLIVRFRQWUDFWRUVKDOOVXEPLWSODQVSULRUWRPDNLQJPRGLILFDWLRQV )LUH+D]DUG6HYHULW\=RQH&RQVXOWPDSVDYDLODEOHDWEXLOGLQJGHSDUWPHQWRURQ2&)$ZHEVLWHWRGHWHUPLQHLI\RXUVLWHLVORFDWHG LQD)+6=%XLOGLQJVLQD)+6=PD\EHVXEMHFWWRVSHFLDOFRQVWUXFWLRQUHTXLUHPHQWVGHWDLOHGLQ&%&&KDSWHU$RU&5&5² /ŶŝƚŝĂůƐWKHEXLOGLQJGHSDUWPHQWZLOOGHWHUPLQHVSHFLILFUHTXLUHPHQWV ,FHUWLI\XQGHUSHQDOW\RISHUMXU\XQGHUWKHODZVRIWKH6WDWHRI&DOLIRUQLDWKDWWKHDERYHLVWUXH 3ULQW1DPH6LJQDWXUH 3KRQH1XPEHU;'DWHͬ %XLOGLQJ'HSDUWPHQW,I\RXKDYHYHULILHGWKDWDOORIWKHTXHVWLRQVKDYHEHHQDQVZHUHGDFFXUDWHO\DV³12´DQGWKHSURMHFWGRHVQRWRWKHUZLVHUHTXLUH2&)$ UHYLHZRIVSULQNOHURUDODUPSODQV WKHQ\RXPD\DFFHSWWKLVVLJQHGIRUPDVDZULWWHQUHOHDVHWKDW2&)$UHYLHZLVQRWUHTXLUHG6KRXOG\RXVWLOOUHTXLUHWKDWWKH DSSOLFDQWKDYHSODQVDSSURYHGE\2&)$SOHDVHLQLWLDOKHUH RUDWWDFKDQ2&)$UHIHUUDOIRUPDQGKDYHWKHDSSOLFDQWVXEPLWWKHIRUPDORQJZLWKWKH DSSURSULDWHSODQVDQGIHHVIRU2&)$UHYLHZ ϭϬͲϬϴͲϭϰ KD 2907 OAK ST. ✔ INSTALL ONE (1) PAINT SPRAY BOOTH. ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ ✔ Mateo Mondragon Digitally signed by Mateo Mondragon Date: 2024.12.04 13:15:17 -08'00' Mateo Mond ragon Digitally signed by Mateo Mondragon Date: 2024.12.04 13:15:35 -08'00' Mateo Mondragon Digitally signed by Mateo Mondragon Date: 2024.12.04 13:15:52 -08'00'Mateo Mondragon 626 7055797 12 02 2024 SANTA ANA, CA 2907 S Oak St 4/24/2025 O R A N G E C O U N T Y F I R E A U T H O R I T Y Plan Referral Form Required for OCFA to review plans upon the request of the Building Department when the answers on the Plan Submittal Criteria Form (on the reverse) are all “No”. City / County Official Requesting Review: City / County Reference #: Date: __________________________________ City / County: _____________________________________ E-Mail: __________________________________ Contact Name: _____________________________________ Phone #: _________________________________ Title: _____________________________________ ** Have the applicant complete and sign the OCFA Plan Submittal Criteria Form on the reverse of this form. ** Reason(s) for Review: Please describe why OCFA Plan Review is or may be required by the City/County : OCFA COMMENTS: No further action required on this specific plan type, based on information provided on: ____/______/______. Project to be taken in for OCFA Review. Other: Name: _________________________________________ Contact #: ______________________________________ Date: _________________________________ Updated: 06/02/2020 rs 2907 S Oak St 4/24/2025